KEGG   Dendrobium officinale: 110115366Help
Entry
110115366         CDS       T05027                                 

Definition
(RefSeq) beta-galactosidase 8
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
dct  Dendrobium officinale
Pathway
dct00052  Galactose metabolism
dct00511  Other glycan degradation
dct00531  Glycosaminoglycan degradation
dct00600  Sphingolipid metabolism
dct00604  Glycosphingolipid biosynthesis - ganglio series
dct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dct00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110115366
  Lipid metabolism
   00600 Sphingolipid metabolism
    110115366
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    110115366
   00604 Glycosphingolipid biosynthesis - ganglio series
    110115366
   00511 Other glycan degradation
    110115366
Enzymes [BR:dct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     110115366
Exosome [BR:dct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110115366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42
Motif
Other DBs
NCBI-GeneID: 110115366
NCBI-ProteinID: XP_020704244
LinkDB All DBs
Position
Unknown
AA seq 640 aa AA seqDB search
MASRGIALLYLQFLLAAFFFVSFIPALASIPKHSSSDSSRPHSFHKDNIRGFKIAGDMFW
KDGQPFRIIGGDLHYFRVLPEYWEDRLLRAKALGLNAIQTYVAWNLHEPSPQKWVFEGIA
NIESFLNLTQELGFLVMLRAGPYICAEWDLGGFPAWLLSIKPSLKLRSSDPRYINLVERW
WGILLPKIAPFLYENGGPIVMVQVENEFGSFGYDKTYLRYLATLARRHLGNDIILYTTDG
GTKDTLERGTIPEEGVYAAVDFSTGENPWPIFELQKRYNAPGKSPPLSAEFYTGWLTHWG
EPNAKTSASYTAAYLEKILSCNGSVVLYMAYGGTNFGFFNGANTGQNDSDYKADLTSYDY
DAPIKESGDVDNPKFEALRNVIEKYSPMSLPPVPSSNERAKYRILNVNKVASLFNVLDIL
CYPTEVVETDQPIPMELVGQMFGFMLYVSQYSGKGSNSTLSIPKVHDRAQVFISCTADGK
GENPTYVGTIERWSNKELELPNFKCSSNISLFILLENMGRINYGPYIYDRKLFSARNSSK
ANRQRVGVINIPNNKMINKRNLWCIWISRLGILSSVALDGYILHGWKLYPISLDKLSLSN
ETLVRKLAESQTAKISIQTSIKFHSGRFTSTQSNESVCFS
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgaggaatcgcattgctctaccttcaattcctactcgccgccttctttttc
gtctccttcattccagctcttgcgtctattcctaagcattcgagctccgattcttctcga
ccccatagttttcataaggacaatattcgaggcttcaaaatagctggtgacatgttctgg
aaagacggacagccttttaggatcattggcggggacttgcattattttcgtgttcttcct
gagtattgggaagatagactgctaagagcaaaagcattgggcttgaatgccatccagaca
tatgttgcgtggaacttgcatgagccttcgccccagaagtgggtttttgaaggcattgca
aatattgaatcatttctaaaccttacacaagaattaggatttttggtgatgcttcgtgct
gggccgtatatatgtgcagaatgggatcttggtggctttcctgcttggctactttctata
aagccttctctgaagctaaggtcttcagatcctaggtacattaatctggttgagagatgg
tggggaattttacttcctaaaattgctccatttctgtatgagaatggtggccctattgtc
atggttcaggttgaaaatgagtttggatcatttgggtatgacaaaacgtaccttcgctac
ctagctactttggccagaagacatcttgggaatgatataattctatatactacagatgga
ggcactaaggatacattagaaaggggtacaattcctgaagaaggcgtttatgcagctgtt
gatttttctactggagaaaatccatggccaatatttgagttgcagaagaggtataatgct
cccggcaaatcacctcctttatcagctgaattttatacaggttggctaacgcattggggt
gaaccaaatgcaaaaacaagtgctagttataccgctgcttacctagaaaagatcttatct
tgcaatggttctgttgttctctatatggcttatggcggaaccaactttggattttttaat
ggtgcaaatactggtcaaaatgattctgactacaaggctgatcttacttcttatgattat
gatgctccaatcaaagaatctggtgatgtggataatccaaaatttgaagcactcagaaat
gtgattgaaaagtacagcccaatgtctcttcctcctgtaccttcttctaatgaaagagca
aaatataggatattgaacgtgaataaggttgcatctcttttcaatgttcttgatatttta
tgttatcctacggaggtggttgaaactgaccagcccattccaatggaactagttggccag
atgtttggttttatgttgtatgtatcccaatacagtggaaaaggaagcaatagcactctt
tctattccaaaggttcatgatagagcccaagtgtttatttcatgcacagcagatggtaag
ggggaaaatccaacatatgttggtactattgagagatggtcaaataaggaacttgagctt
cccaatttcaaatgctcatcaaatattagcctatttattttgttggaaaacatgggacgc
ataaattatggaccatacatttatgacaggaagctcttcagtgctagaaattctagcaaa
gccaatcgacagagagttggggtcatcaatatccccaacaacaagatgatcaacaagaga
aatctctggtgtatctggattagtagacttggaatactttcatctgtagctttagatggc
tatattctccacggttggaaattgtatccgatttccttggacaagctaagcctttcaaat
gagactctagtcagaaaactggcagaatctcaaactgccaagatttctatccagactagt
ataaaatttcattcaggtaggttcacttctactcaaagtaacgaatcagtctgcttttct
taa

DBGET integrated database retrieval system