KEGG   Dickeya paradisiaca: Dd703_1784Help
Entry
Dd703_1784        CDS       T00927                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
dda  Dickeya paradisiaca
Pathway
dda00250  Alanine, aspartate and glutamate metabolism
dda00410  beta-Alanine metabolism
dda00640  Propanoate metabolism
dda00650  Butanoate metabolism
dda01100  Metabolic pathways
dda01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dd703_1784
   00650 Butanoate metabolism
    Dd703_1784
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dd703_1784
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dd703_1784
Enzymes [BR:dda01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Dd703_1784
Amino acid related enzymes [BR:dda01007]
 Aminotransferase (transaminase)
  Class III
   Dd703_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ACS85580
JGI: Dd703_1784
UniProt: C6C4X0
LinkDB All DBs
Position
2125208..2126473
Genome map
AA seq 421 aa AA seqDB search
MKNSELNQRRLAATPRGVGVMCDFFAAKAENATLWDEEGREYIDFAAGIAVLNTGHRHPK
LLAAVREQLEKFTHTAYQVVPYGSYIELAERINALAPIDGPAKTTFFTTGAEAVENAVKI
ARAHTKRPGVIAFGAAFHGRTLLTLTLTGKVAPYSTGFGPFPGSIFHALYPNALHGVSVE
QALDSIDRLFHTDIAADQVAAILLEPVQGEGGFNVAPPEFISGLRKLCDKHGMLLIADEV
QTGFARTGKLFAMEYYEDKADLITMAKSLGGGFPISGVVGRADVMDAPNPGGLGGTYAGN
PLAVASALAVLDVIAEEKLCQRAQQLGATLVEALENAKATCPAIVDIRARGSMVAVEFND
PQTGKPSADITKKYQKAALEQGLLLLTCGTHGNVIRFLYPLTIPDAQFSNALSILSGVLA
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagcgaattgaatcaacgccgtttggccgccacgccccgtggtgtgggagtg
atgtgtgatttctttgctgccaaagcggagaatgccacgctgtgggatgaggaagggcgt
gaatatattgattttgctgccggtatcgcggtactgaacaccgggcaccgccacccgaaa
ctgctggccgcggtacgcgaacagttggaaaaatttacccataccgcttatcaggtggtg
ccttacggcagctatatcgaactggcggaacgtattaacgcgctggcgccgatcgacggc
ccggcgaagaccaccttcttcaccacgggtgccgaagcggttgagaatgcagtaaaaatc
gcccgcgcgcataccaaacgccccggcgtgatcgcctttggcgccgcctttcacggccgc
accctgttgacgctgacgctgaccggtaaagtggctccttattccaccggttttggtccg
ttccccggatccattttccatgcgctgtatccgaatgcgctgcacggtgtgagcgtcgaa
caggcgctggacagcattgaccgtctgttccacaccgacatcgccgccgatcaggtcgcc
gcgattctgctggagccagtgcagggggaaggcgggtttaacgtggcgccgccggagttt
atcagcggcctgcgtaaactgtgcgacaaacacggcatgttgctgatcgccgatgaagta
cagaccgggtttgcccgtaccggcaagctgttcgcgatggaatattacgaagacaaagcg
gatctgatcaccatggcgaaaagcctgggcggcggtttcccgatttccggtgtcgtcggc
cgcgccgacgtgatggacgcaccgaaccccggcggcctgggcggcacctatgccggcaac
ccgctggcggtggcgtcggcgctggcggtgctggatgtgatcgccgaggaaaaactgtgc
cagcgggcgcagcaactgggcgctacactggtggaagcgctggaaaacgcgaaagcgacc
tgtccggcgattgtcgacatccgtgcccgcggttccatggtggcggtcgaattcaatgac
ccgcagaccggcaagcccagcgcggacatcaccaaaaaatatcagaaagccgcgctggaa
caggggctgctgctgctgacctgcggaacacacggcaacgtgatccgtttcctgtatccg
ctgaccattcctgacgcccagttcagcaacgcgctgtccatcctgtccggcgttctggcg
aagtaa

DBGET integrated database retrieval system