KEGG   Dickeya dadantii Ech703: Dd703_3243Help
Entry
Dd703_3243        CDS       T00927                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dda  Dickeya dadantii Ech703
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dd703_3243
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dd703_3243
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Dd703_3243
Enzymes [BR:dda01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Dd703_3243
Peptidoglycan biosynthesis and degradation proteins [BR:dda01011]
 Precursor biosynthesis
  Amino acid ligase
   Dd703_3243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3798925..3800025
Genome map
AA seq 366 aa AA seqDB search
MSKIRVGVVFGGKSSEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKQGAWHLNDASNYLLN
ANNPSLIALNRSSRNIALVPGQSHNQLIETSNASALSQIDVIFPIVHGTLGEDGSLQGLL
RMANIPFVGSSVLGSAVSMDKDVTKRLLRDTGLMVAPFVTLTRANRERHHFADITARLGL
PLFIKPANQGSSVGVSKVRNEAQYQQAVELAFSYDHKVLVESAIVGREIECAVLGNDHPE
ASVCGEIVVHDEFYSYDTKYISEDGAAVAIPAPMPDSTHQRIREIAVQAFQALDCQGMAR
VDVFLTPQEDVIVNEVNTLPGFTNISMYPKLWEATGIGYTALITRLIELAQERHAQDSNL
QSSVQR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaattcgggttggcgtggtttttggtggtaaatcctctgagcacgaagtgtca
ctgcagtccgcaaaaaatattgtggacgcgattgataaaacgcgatttgacgtcgtactg
ctgggtatcgataaacaaggagcatggcatctcaacgatgcgtccaattatctgctcaac
gccaataatccgtcgctgatcgcgctcaaccgctccagccgcaatatagctttggtgccc
ggtcaatcccataatcagttgattgaaaccagcaacgccagcgccctgtcacagattgac
gtgatcttcccgatcgtacacggcacgctgggcgaagacggttcgctacaggggctgctg
cgtatggccaatattccgtttgtcggcagcagcgtgctcggttctgcggtcagtatggat
aaagatgtcaccaaacgcctgctgcgcgataccggcctgatggtcgcgccgttcgtcacg
ctgacccgcgccaaccgcgaacgccatcacttcgccgacatcaccgcccgcctcgggctg
ccgctgttcatcaaaccggccaaccagggttcttccgtcggcgtcagcaaagtgcgcaac
gaagcgcaataccagcaagcggtcgaactggcgttcagttatgaccacaaggtattggtg
gaatccgcgattgtcggccgtgaaatcgagtgcgcggtgctgggcaacgaccaccctgaa
gccagcgtctgcggcgaaatcgtggtgcatgacgaattctattcctacgataccaaatac
atcagtgaagacggcgcggcggtggcaatccccgcgccgatgccggacagcacccatcag
cgtatccgcgagatcgccgttcaggcgtttcaggcgctggattgtcagggaatggcgcgg
gtagacgtgtttctgaccccgcaggaagacgtgattgtcaacgaagtgaatacgttgccg
ggcttcaccaacatcagtatgtatcccaaactctgggaagccaccggcatcggttatacc
gccctgattacccggctgattgaactggctcaggagcgccacgcgcaagacagcaacctg
caaagctccgtgcaacgctaa

DBGET integrated database retrieval system