KEGG   Dickeya paradisiaca: Dd703_3809Help
Entry
Dd703_3809        CDS       T00927                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
dda  Dickeya paradisiaca
Pathway
dda00730  Thiamine metabolism
dda00790  Folate biosynthesis
dda01100  Metabolic pathways
dda02020  Two-component system
Module
dda_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Dd703_3809
   00790 Folate biosynthesis
    Dd703_3809
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dd703_3809
Enzymes [BR:dda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dd703_3809
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd703_3809
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dda00537]
 Enzymes
  Dd703_3809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase NYN_YacP
Motif
Other DBs
NCBI-ProteinID: ACS87562
JGI: Dd703_3809
UniProt: C6C5C5
LinkDB All DBs
Position
4423674..4425077
Genome map
AA seq 467 aa AA seqDB search
MIKKTLISSLVMTLVAANAIAADAAYVRQAAGDITQPGGARRLSADQTEMLKAALNAKTA
KNVILLIGDGMGDSEITVARNYAMGAGGFFKGIDALPLTGQYTHYSLDKKTRKPDYVTDS
AASATAWSSGVKTYNGALGVDVDGKDHKTLLEIAKAAGKATGNVSTAELEDATPAAMISH
VTSRKCYGPEKTSQQCATNAQENGGRGSIAEQLLVARADVTLGGGAATFKEVAKAGKYQG
KTLLEQAQALGYNLVTDLDSLSAVNVASQNKPVLGLFADGNMPVRWQGPKASYHGNLDKP
VITCEPNAQRTAATPTLAQMTDKAIQLLSKNKNGFFLQVEGASIDKQDHAANPCGQIGET
VDLDEAVQKALEFARRDGNTLVIVTADHAHSSQIIENGAKAPGLTQALNTKDNAVMTISY
GNSEEESQGHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKSAMGLK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaagaccctgatttcctctctggtaatgacactggttgccgctaatgccatc
gctgccgatgccgcctacgttcgtcaggccgcaggcgatatcactcagccaggcggcgca
cgccgtctcagtgccgatcaaactgaaatgctgaaggcggcgctcaatgccaaaacggca
aaaaacgtcattctgctgattggcgatggcatgggagactctgaaattacggtagcccgc
aactatgcaatgggcgccggcggttttttcaaaggcattgacgctttgccattaaccggc
caatacacccattactcactggataaaaaaacccgcaaaccggattacgtgaccgactcc
gctgcgtccgccacggcctggtcaagcggtgtgaaaacctacaacggcgcgctgggcgtg
gatgttgacggcaaagaccacaaaaccctgctggaaatcgccaaagcagcgggcaaagcc
accggcaacgtctccaccgccgaattggaagacgctaccccagcagccatgatctcgcac
gtcacttcccgtaaatgttacggcccggaaaaaaccagccaacaatgcgccaccaatgcg
caggaaaacggcggccgcggttctattgccgaacaactgctggttgcccgcgccgacgtc
acgctgggcggcggtgcggcgacattcaaagaagtggccaaggcaggcaaatatcagggt
aaaacgctgctggaacaggcgcaggcgctgggctataacctggtgactgatctggacagc
cttagcgcagtgaacgtggccagtcagaacaaaccggtgctgggcctgtttgccgacggc
aatatgccggtacgctggcaggggccgaaagcctcctatcacggcaatctcgacaagccg
gttatcacctgcgagccaaatgcacagcgtacagctgcaacgccgacactggcacaaatg
acagacaaagccatccaattgttgagtaagaacaaaaatgggtttttcctgcaggttgaa
ggcgcgtctatcgacaaacaagaccacgccgccaacccatgcggccagatcggcgaaacg
gtagatctggatgaagcggttcagaaagcgctggaatttgcccgtcgtgacggcaatacg
ctggtgatcgtcaccgccgaccacgcgcactccagccagattatcgagaatggcgccaaa
gcgccgggtctgacgcaggcgctgaacaccaaagacaacgccgtcatgaccatcagctac
ggcaattcggaagaggaatcacagggtcataccggcactcagctacgtatcgcggcttac
ggcccgcacgccgccaacgtggtagggctgactgaccagactgacctgttctacaccatg
aaaagcgccatgggcctgaaataa

DBGET integrated database retrieval system