KEGG   Dickeya zeae Ech586: Dd586_0065Help
Entry
Dd586_0065        CDS       T01138                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ddc  Dickeya zeae Ech586
Brite
Enzymes [BR:ddc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dd586_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(79906..80532)
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDAQTMEIHHSKHHQAYVNNANAALESLPEFASLSAEELITK
LDQLPADKKGPLRNNAGGHANHSLFWKGLKLGTTLEGELKAAIERDFGSVDEFKTKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGASGYPLIALDVWEHAYYLKYQ
NRRPDYIKAFWSVVNWDEAAKRFAEAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatccctgccttatgcttatgacgcactggagccgcacttcgac
gcgcagacgatggaaatccatcactccaaacaccaccaggcttacgtcaataacgctaac
gcagcgctggagtccctgcctgaattcgccagcctgtctgccgaagagttgatcaccaaa
ctggatcaactgcctgccgacaagaaaggcccgctgcgtaataacgccggtggccatgcc
aaccacagcctgttctggaaagggctgaaactgggcaccacgctggaaggcgaactgaaa
gcggcgattgagcgtgatttcggcagcgttgacgagttcaaaacaaaattcgagcaggct
gccgcaacccgtttcggttcaggctgggcgtggctggtactgaaagatgacggcaagctg
gctgtggtttctaccgccaaccaggacagcccgctgatgggtgaagcgatttccggtgca
tccggctacccgctcatcgcgctggacgtgtgggaacacgcctactacctgaaatatcag
aaccgtcgcccggattacatcaaagccttctggagcgttgtaaactgggacgaagcggct
aagcgtttcgctgaagcgaaaaagtaa

DBGET integrated database retrieval system