KEGG   Dickeya zeae Ech586: Dd586_2189Help
Entry
Dd586_2189        CDS       T01138                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00010  Glycolysis / Gluconeogenesis
ddc00230  Purine metabolism
ddc00620  Pyruvate metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01120  Microbial metabolism in diverse environments
ddc01130  Biosynthesis of antibiotics
ddc01200  Carbon metabolism
ddc01230  Biosynthesis of amino acids
Module
ddc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ddc_M00002  Glycolysis, core module involving three-carbon compounds
ddc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ddc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd586_2189
   00620 Pyruvate metabolism
    Dd586_2189
  Nucleotide metabolism
   00230 Purine metabolism
    Dd586_2189
Enzymes [BR:ddc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Dd586_2189
Membrane trafficking [BR:ddc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dd586_2189
Exosome [BR:ddc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dd586_2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-ProteinID: ACZ77043
JGI: Dd586_2189
UniProt: D2C0X2
LinkDB All DBs
Position
2477074..2478516
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKIIAAGANVVRLNFSHGTPEDHLLRADKVREIAAK
LGRHVAILGDLQGPKIRVSTFKEGKIFLNVGDKFLLDANLEKGEGDKERVGIDYKGLPND
VVPGDILLLDDGRVQLKVLAVDGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKA
DIVTAAKIGVDFLAVSFPRTGEDLHYARRLAREAGSNAKIVSKVERAEAVSTDEAMDDII
LASDVVMVARGDLGVEIGDPELVGIQKKLIRRARQLNRSVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPAETVAAMAKVCLGAEKIPSINVSKHRLDVQFDN
VEESIAMSAMYAANHLNGVTAIIAMTESGRTALMMSRISSGLPIFAMSRHEHTLNLTALY
RGVTPVQFTSYTDGVAAANDAVLLLRDKGFLVSGDLVIVTQGDVMGTVGTTNTVRVLRVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagacggctcagaagaaccaaaatcgttaccacgctggggccggctacggaccgc
gacaataatctggaaaagatcattgccgcaggcgcaaacgtagtccgcctgaacttttct
cacggtacgccggaagaccatcttctgcgggccgataaagttcgcgaaatcgcagctaaa
cttggccgccatgttgccattctgggtgatcttcaggggcccaagattcgtgtatcgacc
ttcaaagaagggaaaattttcctgaatgtcggcgacaagttcctgctggatgccaatctg
gaaaaaggcgaaggcgacaaagagagagtgggtatcgactataaaggattacccaacgat
gtggttccaggcgatattctgctgctggatgatggccgtgtgcagttaaaagtactggca
gtcgatggcatgaaagtgttcaccgaagtcactgtcggcggtccgttgtctaacaacaaa
ggcatcaacaaactcggtggcggcctgtcggcggaagcgttaacagaaaaagataaagcg
gacatcgttaccgcagccaaaatcggtgtagatttcctggcggtctctttccctcgtact
ggcgaagacctgcactatgcccgtcgtctggctcgcgaagctggcagcaacgccaaaatt
gtgtcgaaagtagaacgtgcagaagccgtatcaacggatgaagcaatggatgacattatc
cttgcttctgatgtggtcatggtggctcgcggtgatctgggtgtggaaatcggcgacccg
gaactggtcggtatccagaaaaaactgattcgccgtgctcgtcaattgaaccgttccgtt
attacggcaacgcagatgatggagtcgatgatcaccaatccgatgccaacccgcgcggaa
gtgatggacgtcgccaacgccgtactcgacggcaccgatgccgtgatgctctctgcagaa
actgcggcgggtcagtacccggcagaaacagttgccgcgatggctaaagtgtgtctgggc
gcagaaaagatccccagcatcaatgtctccaaacatcgccttgacgtgcagttcgataac
gtggaggagtcaatcgccatgtccgcaatgtatgcggccaaccaccttaacggtgttacc
gcgattatcgccatgaccgaatccggccgcaccgcactgatgatgtctcgtatcagttca
ggcctgccgattttcgctatgtcgcgtcatgagcatacccttaacctgactgccttgtac
cgtggtgtcactccggtgcagttcaccagctataccgatggcgtcgctgcagctaatgat
gccgtactgctgctgcgtgacaaaggcttcctggtctccggcgatctggttatcgtaacc
caaggggatgtcatgggaacggtcggtaccaccaatacagtgcgtgtgctgcgggttgaa
taa

DBGET integrated database retrieval system