KEGG   Dickeya dadantii 3937: Dda3937_00335Help
Entry
Dda3937_00335     CDS       T01305                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase, aerobic, FAD/NAD(P)-binding protein
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dda3937_00335 (glpD)
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dda3937_00335 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4486540..4488039
Genome map
AA seq 499 aa AA seqDB search
METKDLIVIGGGINGTGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVGEALSEREVLLKMAPHIIFPMRFRLPHQPHLRPAWMIRAGLFMYDHLGKRVSLPPS
HGLRFGRESVLKPELTRGFEYSDCWVDDARLVVLNAQEVVRRGGEVKTRMTVTRARRENG
LWVVEAEDALSGETHRWQAKGLVNATGPWVRQFFDDSLALPSPYGIRLIKGSHIVVPRVH
QEEQAYILQNKDHRIVFVIPWQDEFSIIGTTDVEYHGDPHQVKIDDNEIRYLLDVYNDHF
KKQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVADESGKAPLLSVFGGKLTTYRK
LAEHAMDKLAKYYPQAGQAWTNRAILPGGDISGSREDYAATLRRRYNLPEALARRYSRTY
GTQSEKILGNAQALSDLGEHFGHNLYEAELRYLVEHEWVVTLADAIWRRTKLGMWLDDAQ
QQRISEWLADYRSQLAKAG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgatcgtgatcggcggaggcattaacggtaccggcatagcggcg
gatgccgccgggcgcgggctgtccgttctgttgctggaagcgcaggatttagcctgcgcc
acctcttccgccagctcaaaactgattcatggcggcctgcgctacctggaacactatgag
ttccggctggtgggggaagcgctgtccgaacgcgaagtgctgctgaaaatggcgccgcac
atcatttttccgatgcgttttcgcctgccgcaccagccgcatctgcgtccggcctggatg
attcgcgccggtttgttcatgtacgaccatctgggcaaacgcgtcagcctgccgcccagc
cacgggctgcgattcggccgcgaatcggtgctgaaaccagaactgacgcgcggtttcgaa
tattccgactgctgggtggacgatgcccgcctggtggtgctgaacgcgcaggaagtggtg
cgccgcggcggcgaggtgaaaacgcgcatgaccgtcacccgcgcccgccgcgaaaacggc
ctgtgggtggtggaagccgaagatgccctgagcggcgagacccatcgctggcaggcgaaa
gggctggtcaacgccaccggcccgtgggtacgccagttctttgacgacagtctggcgctg
ccgtcgccgtacggcatccggctgatcaaaggcagccatatcgtggttccgcgcgtgcat
caggaagagcaggcctacattctgcagaataaagaccaccgcatcgtgtttgtgattccg
tggcaggatgagttttctatcatcggcaccaccgatgtggagtaccacggcgatccgcat
caggtgaagattgacgacaacgaaattcgttatctgctggacgtatacaacgatcacttc
aaaaaacagctgacgcgcgacgacattgtctggacctactcaggcgtgcgcccgctgtgc
gacgacgaatcggattcgccgcaggccatcacccgcgattacacgctgtcggtggcggat
gaaagcggtaaagcgccgctactgtcggtgttcggcggtaagctgaccacctaccggaaa
ctggcggaacacgccatggataagctggcgaagtactacccgcaagcgggccaggcctgg
accaaccgcgccatcctgcccggcggcgatatcagcggcagccgcgaagattacgccgca
accttgcgccgccgctacaacctgccggaagcgctggcgcgtcgctacagccgcacttac
ggcacccagagcgagaaaatactcggtaacgcgcaggcgctgagcgatttgggtgaacat
ttcggccataacctgtacgaagccgagttacgttatctggtagaacatgagtgggttgtc
acgctggcagacgctatctggcgccgcaccaagctcggcatgtggctggacgacgcccag
cagcagcgtattagtgaatggctggcggactaccgcagccagttagccaaggccggttaa

DBGET integrated database retrieval system