KEGG   Desulfitobacterium dichloroeliminans: Desdi_0433Help
Entry
Desdi_0433        CDS       T02390                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
ddl  Desulfitobacterium dichloroeliminans
Brite
Translation factors [BR:ddl03012]
 Eukaryotic Type
  Elongation factors
   Desdi_0433
 Prokaryotic Type
   Desdi_0433
Mitochondrial biogenesis [BR:ddl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Desdi_0433
Exosome [BR:ddl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Desdi_0433
  Exosomal proteins of breast cancer cells
   Desdi_0433
  Exosomal proteins of colorectal cancer cells
   Desdi_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
459885..461087
Genome map
AA seq 400 aa AA seqDB search
MAKQKYERNKPHVNVGTIGHVDHGKTTTTAAITSVLSKAGGAVAQAFDQIDKAPEERERG
ITISTSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVWLNKADMVDDPELMELVEMEIRELLSEYEFPGDDIPIVPGSGLKALQ
CGCGQRDCEWCGKIWNLMDAVDSYIPNPERATDKPFLMPVEDVFTITGRGTVATGRVERG
VIKVGDEVEIVGLTEAPRKSVCTGVEMFRKLLDQAQAGDNIGALLRGVDRKDIERGQVLA
KPGSIKPHTKFTGEVFILSKEEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGTEMVMPG
DRVTISCELITPIAMEEGLRFAIREGGRTVGAGVVVSIVE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcaaaaatacgaacgtaataaaccccacgttaacgttggaaccatcggtcac
gttgaccatggtaaaaccaccactaccgccgcaatcacctctgttctttccaaagctggc
ggcgcagttgctcaagccttcgatcaaatcgacaaggctcctgaagaaagagaacgtggt
atcaccatctctacttctcacgttgagtatgaaactgctaatcgtcactatgcacacgtt
gactgcccaggccacgccgactatgttaaaaacatgatcactggtgctgcgcaaatggac
ggagctatcctcgtagtgtctgctgctgatggccctatgccacaaactcgtgagcacatc
ctgcttgctcgtcaagtaggtgttccttatatcgttgtatggcttaataaagctgacatg
gttgatgatccggaacttatggaactcgttgaaatggaaattcgtgaactccttagtgag
tatgaattccctggcgacgatatccccatcgttcctggttcaggcctcaaagctctccaa
tgcggttgcggacaacgcgattgcgaatggtgtggtaagatctggaacctcatggatgct
gttgattcctatattcctaatccagaacgtgctactgacaagcctttcctcatgcccgta
gaggacgtgttcacgattaccggtcgtggaacggttgctactggtcgtgtagagcgcgga
gttattaaagtcggtgacgaagttgaaatcgttggtttgactgaagctcctcgtaagagc
gtttgtactggtgttgaaatgttccgtaagcttcttgaccaagctcaagctggggacaac
ataggagctcttcttcgtggtgtggatcgtaaagatatcgaacgcggtcaagtacttgct
aaacccggttctatcaaacctcacaccaaatttactggcgaggtattcatcctcagtaaa
gaagaaggtggacgtcatactccattcttcaacaactatcgcccacaattctattttcgt
acaaccgacgttaccggcgttgtaacccttcctgaaggaactgaaatggttatgcctggt
gaccgtgtgactatctcttgcgaactgatcactcccatcgctatggaagaaggacttcgc
ttcgctatccgcgaaggtggacgtaccgttggtgctggagttgtagtaagcatcgtcgaa
tag

DBGET integrated database retrieval system