KEGG   Deinococcus deserti: Deide_03170Help
Entry
Deide_03170       CDS       T00880                                 

Gene name
aceF
Definition
(GenBank) putative Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ddr  Deinococcus deserti
Pathway
ddr00010  Glycolysis / Gluconeogenesis
ddr00020  Citrate cycle (TCA cycle)
ddr00620  Pyruvate metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
ddr01130  Biosynthesis of antibiotics
ddr01200  Carbon metabolism
Module
ddr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deide_03170 (aceF)
   00020 Citrate cycle (TCA cycle)
    Deide_03170 (aceF)
   00620 Pyruvate metabolism
    Deide_03170 (aceF)
Enzymes [BR:ddr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Deide_03170 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H HlyD_3 NQRA DUF2254
Motif
Other DBs
NCBI-ProteinID: ACO45137
UniProt: C1CZ99
LinkDB All DBs
Position
353470..355332
Genome map
AA seq 620 aa AA seqDB search
MATQLNLPDVGDNIEKGTVVTVLINPGDTVTEGQPIIEIETDKAVVEVPASASGTVEAVN
VKVGDTVPVGGLIATLGGGTASGAAPATADAGAAKTGNLPDNAAEPDSSTVADQAETAHR
VAAAQVESQKEQAHQGGGQVPAASAPAPQQAAPAAGGSAQQVTLPDVGDNIEQGIIVSIL
VNVGDTVTEGQPVVELETDKAVVEVPSSAAGTVEAVNVKVGDPVRIGGVLLTLAGGAPAA
AAPAAQDNAPAQAAPAQSAPAQDAPATASLSSERPAAANSASLPPERAQPATQQPGAERP
YNTQSYDGRQLIPAAPSVRRLARELRVDIYEVQGTGIAGRISEEDVRRTLAGTQGQTTAA
ASAAPAAQAAAAPRAAAPVALPNFEKWGGVRREDMSGIRKATVRSMTASWSTIPMVTHFD
KADVTLMEETRKRFAARVEKAGGKLTMTHILMKVVANALHKFPKFGASLDLAAEQVVYKD
YVNIGVAVDTPVGLLVPVVKDADRKSITDLVLELSELAGRARDRKLKPDEMQGATFTISN
LGGIGGHAFTPIVNSPEVAILGVSRGGFEPVWNKETSSFEPRNMLPVSLTYDHRLIDGAD
AARFVRFICESLEDPFLISL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccagctgaacctccccgacgtgggggacaacatcgagaaaggtacggtcgtg
accgtgctgatcaacccgggtgacaccgtcaccgaaggccagccgatcattgagatcgag
accgacaaggccgtggtcgaagtaccggccagtgcgtcaggaaccgtagaagccgtgaat
gtgaaggtcggagacaccgtgccggtgggcggcctgattgccacgctggggggcggaact
gcctctggtgccgcaccagccaccgctgacgcaggagccgcgaagactggcaacctgccc
gacaacgccgccgagccggattccagcaccgtagcggatcaggcagaaacggcccaccgt
gtcgcagctgcccaggtggaaagccagaaggaacaggcgcatcagggtggggggcaggtg
ccggcagccagtgcgccagccccgcagcaggctgcaccggccgctggtggctcagcccag
caggtcacgctgccggacgttggagacaacatcgagcagggcatcatcgtgtccattctg
gtcaacgtcggggacacggtcaccgagggccagccggtggtggaactggagaccgacaag
gccgtggtcgaggtgccttccagtgcggccggcaccgttgaggctgtgaatgtgaaggtc
ggagacccggtgcggatcggtggcgtgctgctcacgctggcaggaggagctccggcagcg
gcggcgcccgcagctcaggacaacgcaccagctcaggcagctcccgcccagtccgctcct
gcgcaggacgcgccggccaccgccagtctcagtagcgaacgccccgctgcagccaacagt
gccagtctgccgccggaacgcgcccagcccgccacccagcagccgggagccgagcgtccc
tacaacacccagtcctacgacggccgccagctcattcctgcggctcccagtgtgcggcgc
ctggcgcgggaactgcgcgtggacatttatgaggtgcagggcaccggcattgccgggcgc
atcagcgaggaagacgtgcggcgcaccctggctggcactcagggccagacgactgctgct
gcgtcggctgctccagcggcccaggcagctgccgcgccccgcgctgctgcacctgtggct
ctgcccaacttcgagaagtggggtggggtgcgccgcgaggacatgagcgggatccgcaag
gccaccgtgcgctccatgaccgcctcctggagcaccattcccatggtcacgcacttcgac
aaggccgacgtgaccctgatggaagaaacccgcaagcgcttcgcggcgcgcgtggaaaag
gccggcggcaagctgaccatgacccacatcctgatgaaggtcgtggccaatgcgctgcac
aagttccccaagttcggcgcgagcctggatctggccgccgagcaggtggtgtacaaggat
tacgtgaacatcggcgtggccgtggacaccccggtgggcctgctggtcccggtcgtcaag
gacgctgaccgcaagagcatcaccgacctggtgctggaactcagcgaactggccgggcgt
gcccgtgaccgcaagctcaagcctgacgagatgcagggtgcgacctttaccatcagcaac
ctgggaggcattggcgggcacgccttcacgcccatcgtgaactcgcccgaggtggccatc
ctgggagtctcacgcggcggcttcgagccggtgtggaacaaggagaccagcagcttcgag
cctcgtaacatgctgccggtctcgctgacctacgatcaccgcctgatcgacggtgcggac
gctgcccgcttcgtgcgcttcatctgcgagtcgctggaagatcctttcctgatctcgctc
tga

DBGET integrated database retrieval system