KEGG   Dehalobacter sp. DCA: DHBDCA_p1889Help
Entry
DHBDCA_p1889      CDS       T02278                                 

Gene name
tuf
Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ded  Dehalobacter sp. DCA
Brite
Translation factors [BR:ded03012]
 Eukaryotic Type
  Elongation factors
   DHBDCA_p1889 (tuf)
 Prokaryotic Type
   DHBDCA_p1889 (tuf)
Mitochondrial biogenesis [BR:ded03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DHBDCA_p1889 (tuf)
Exosome [BR:ded04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DHBDCA_p1889 (tuf)
  Exosomal proteins of breast cancer cells
   DHBDCA_p1889 (tuf)
  Exosomal proteins of colorectal cancer cells
   DHBDCA_p1889 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AFV02915
LinkDB All DBs
Position
complement(1898200..1899402)
Genome map
AA seq 400 aa AA seqDB search
MGKQKFDRSKPHVNVGTIGHVDHGKTTTTAAITFVLSKVGGAVATAFDQIDKAPEERERG
ITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVWLNKVDMVDDPELLELVEMEVRELLSEYEFPGDDIPVIPGSGLKALE
CGCGQRDCEWCGKIWNLMDAVDSYIPQPERAVDKPFLMPVEDVFTITGRGTVATGRVERG
VLKVGDEIEIVGLSEKPRKSVCTGVEMFRKLLDQAQAGDNIGALLRGVERKDIERGQVLA
KPGSIKPHTKFSGEVYILSKEEGGRHTPFFNNYRPQFYFRTTDVTGVIKLPEGTEMIMPG
DRVSIECELITPIAMEEGLRFAIREGGRTVGSGVVAKVVE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacaaaaatttgaccgttccaagccgcacgttaacgtaggtacaattggccac
gttgaccatggtaaaacgacaacgactgctgcgattacatttgttttgtccaaggtcggc
ggtgctgttgcaactgcatttgatcagatcgacaaagcgcctgaagagcgtgaacgcgga
attacgatttctacagctcacgttgagtatgaaacggcaaaccgtcactatgcgcacgtt
gactgcccaggccatgctgactatgttaaaaacatgatcaccggtgctgctcagatggac
ggtgccatcctggttgtatccgctgctgacggcccgatgcctcagacgcgtgaacacatc
cttcttgcccgtcaggtaggtgtgccttacatcgttgtatggctgaacaaagttgacatg
gttgatgatcctgaacttctcgaactggttgaaatggaagttcgtgagctgttaagtgaa
tatgaatttcccggcgatgatatccctgttattcccggctccggactcaaagctctggag
tgcggatgcggacagagagactgcgaatggtgcggcaaaatctggaatctgatggatgct
gttgacagctatattcctcaaccggaacgtgctgtagacaaaccgttcctgatgcctgta
gaagatgtcttcacgatcactggtcgtggtactgttgctaccggccgtgtagagcgtggt
gtccttaaagtcggcgatgaaattgaaatcgttggtctttctgaaaaaccgcgtaagagt
gtttgcacaggcgttgaaatgttccgtaaactgctcgatcaggctcaggccggtgacaat
atcggcgctctgctgcgtggtgttgagcgcaaagacattgagcgcggacaggttctggct
aaaccaggaagtattaaaccgcatacgaagtttagcggtgaagtttacattctgagtaaa
gaagaaggcggacgtcatacgccgttcttcaacaactaccgtcctcagttctacttcaga
acaaccgacgttactggtgtaatcaaactcccagaaggcacagaaatgattatgcctggt
gaccgcgtatccatcgagtgcgaattgatcacccccattgctatggaagagggactccgc
ttcgctatccgtgaaggcggacgtactgttgggtccggcgttgtagccaaagttgtcgaa
taa

DBGET integrated database retrieval system