KEGG   Desulfovibrio sp. G11: CNY67_12060Help
Entry
CNY67_12060       CDS       T05183                                 

Definition
(GenBank) alpha-glucan family phosphorylase
Organism
def  Desulfovibrio sp. G11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn DUF3417 Phosphorylase Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ATD82032
LinkDB All DBs
Position
2666568..2670833
Genome map
AA seq 1421 aa AA seqDB search
MNFNSSLVTLFEVSWEVCNKVGGIHSVVTSKALQAVEHFGEDYFLLGPALKNNPGFEETD
EHAWDSLRMGLATRDLKCRLGRWNIPGRPKVILVEFDKRYSSNQLLFEMWKNYGVDSLSG
GWDYIEPIMFATACGEVIATIHESRVEPMQGRSVALFHEWMCGAGLLTVKKLTPEVGTVF
TTHATTLGRAMAGTGRDIYTNMRNINPANEAAALNITAKWSMESAAAREADAFTTVSPIT
GEESTVFLGRQPDVITTNGLDLRVIPDYTDDREVPSATRAKIMSAAGRFLRGSLPEHTRI
FTISGRYEMHNKGVDIFLEALARADRNLSGTNSSILALCLVMGGHTGVNAAAVSGNPDDT
DNGMPFICTHRVWNAPQDPIINACRRLGLDNREERRVKVIFVPAMLDGHDGFFDIPYEEI
LAACDMGFFPSWYEPWGYTPQESAAWAVPTLTTDLSGFGMWAREQMKEESMDRTGVCVMP
RRGMSFDQSVDRLHERVLGAAACPEGELCSWRGHARDLAEKTSWSYFFDNYIKAFDIALA
KSDARTDHDSAHGALTRVLTASCSATPFLRPIMAVAEVPHELSRLRELAQNIWWSWHDQA
KALFMALNPQLWEACRNPLKMLEEAWPARLKELIANEEYMAMYHKVMDRFDAYMAEPIRS
LSVDVTPEHPIVYFSTEYGLNESVPIYSGGLGVLSGDHLKSASDMALPLVGIGLLYKSGY
FMQEIDSSGRQVAQYPVNNFGQMPIKQVHDAQGQPVYIQLELPGRILYARVWRLQVGRIS
LYLMDTDTSRNTDEDRRITDRLYEANRETRLLQEILLGQGGMRLLRTLGIIPGVYHMNEG
HSAFMALERVRDCMTQGMSHDEAVVRVRSNTLFTTHTPVPAGNESFSLELMERYFSGMAK
NLDLSWQQFVQLGQIEGGDSHAFEMTVLALRLSCWANGVSRLHGVVSRHMWNNLWKGLPT
AETPIGHVTNGVHTPSYVGSWMHELLHKHLGAGWLQALPGSTVWDKVDDIPDEAFWAARQ
HQKEALLDALRKRIPVFAQRFKLDAAVRKRMEALLRPETLIIGFARRFAPYKRATLLFAD
PDRLARILNNPHRPVVLVFSGKAHPADEAGINLIQEVMRMCQDERFLGRIFFLENYSLSV
SRIMSQGCDVWLNTPRRPHEASGTSGMKLPVNGGINLSISDGWWCEGYNRQNGWTIGPVV
TTELPSNEQNDYADAEALYNLLENAVLPLYFDRTQGDLPTQWIAMAKRSFKSLTAMYGSN
RMLNDYIRQYYLRAARRRNMLAENDWSACRRLAAWEKDLPARFGTVKVEELFISGVENNT
MICGEPVSVRLHMHLGEMQPEEILVQLVIGRALVNGSFIDKPEILRLEPRAADHNGESGN
GMNYAATYIPTHSGQYRYGVRVLPYHKNLATPLETGLVLWA
NT seq 4266 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaactcgtccctggtaaccctgtttgaagtaagctgggaggtctgcaacaag
gtggggggcatccactctgttgtcaccagcaaggccctccaggccgtggagcattttggc
gaggactattttcttcttggtccggccctcaagaacaatcccggctttgaagaaacagac
gaacatgcctgggattcactacgtatgggccttgccacgcgggacctcaagtgccgcctg
ggtcgatggaacatacccggccgccccaaggtaatactggtggaatttgacaagcgctat
tccagcaaccagctactgtttgaaatgtggaaaaactacggggtggactcgctctccggc
ggctgggactatattgagccgatcatgtttgccacagcctgcggcgaggttatcgcgacc
atacacgaaagccgggtagaaccgatgcagggccgcagcgtggccctgtttcacgaatgg
atgtgcggcgcgggcctgctcacggtgaaaaagctcacccctgaagtgggtacggtcttc
accacccacgccaccaccctgggccgcgccatggcaggcacaggacgtgacatctacacc
aacatgcgcaatatcaatcccgccaacgaggccgccgcgctcaacatcacggccaagtgg
tccatggaaagcgccgccgcccgcgaggcggacgccttcaccactgtcagccccataaca
ggtgaagagtccacagtatttctgggtcgccagcctgacgtcatcaccaccaacggcctc
gacctgcgggtcataccggactataccgacgaccgcgaggtcccctcggccacgcgcgcc
aaaatcatgagcgcggcgggacgcttcctgcgcggatccctgccggagcacacgcgcatc
ttcaccatttccggccggtacgaaatgcacaacaagggtgtggatattttccttgaagcc
ctggcacgcgccgaccgcaacctttccggcacaaacagctccatcctggccttgtgtctt
gtgatgggcgggcatacgggcgtcaacgcggccgcggtttccggcaatcctgacgatacg
gacaacggcatgcccttcatatgcacccaccgcgtatggaatgccccgcaagacccgatc
atcaatgcctgccgccgactgggccttgataaccgcgaagaaaggcgcgtcaaggtcatc
tttgtacccgccatgctcgacggccacgacggctttttcgacattccctatgaagaaata
ctggccgcctgcgatatgggcttttttccttcatggtacgaaccgtggggctacacgccg
caggaaagcgcagcctgggccgtgcccacccttaccacagacctttcgggtttcggcatg
tgggcgcgggagcagatgaaagaagaaagcatggaccgcacgggcgtctgcgtcatgccg
aggcgcggcatgagctttgaccagagcgtcgaccggctgcacgaaagagtgctgggggcc
gctgcctgcccggagggtgaactgtgctcctggcgcgggcatgcccgtgatctggctgaa
aagacctcgtggagctattttttcgacaattatatcaaggcatttgacatcgcccttgcc
aagtccgatgcgcgcaccgaccacgattccgcgcacggggcgcttacccgggtgctcacg
gcgtcctgctcggccacgccttttctgcgccccatcatggctgttgccgaggttccgcac
gagctttcgcgcctgcgcgaactggcgcagaacatctggtggagctggcacgatcaggcc
aaggccctgtttatggcgctgaacccccaactgtgggaggcatgccgcaatccgctgaaa
atgcttgaagaagcctggcctgcccgcctcaaagagcttatcgccaatgaagaatacatg
gccatgtaccacaaggttatggacaggttcgacgcctacatggccgaacctatccgctca
ctcagcgtggacgtgacgcccgaacaccccattgtctatttttccactgaatacgggctt
aacgaatccgtgcccatttattccggcggccttggcgtgctttcgggcgaccaccttaaa
tccgcctcggacatggccctgccactggtgggtatcggcctgctctacaaaagcggctat
ttcatgcaggaaatcgattccagcggccgccaggtggcacaatatccggtcaacaatttt
ggccagatgcccataaagcaggtgcatgacgcccagggacagcccgtatacatacagctc
gagctgccgggccgcatcctttacgcccgggtatggcggttacaggtaggccgcataagc
ctctatcttatggacacggacaccagccgcaatacggacgaggatagacgcatcaccgac
cgcctgtatgaggccaaccgcgaaacacgcctgctgcaggaaatactgctcggtcagggc
ggcatgcgcctgttgcgcaccctcggcattatccccggcgtttaccacatgaacgagggg
cattcggcctttatggcccttgagcgcgtgcgggactgcatgacccagggcatgagccat
gacgaagctgtggtgcgtgtacgctccaacacactgtttaccacccacacccccgtgcct
gcgggcaacgaatccttctcgctggaactgatggaacgctatttcagcggtatggcaaaa
aaccttgacctttcctggcaacagttcgtgcagctcgggcagatcgagggcggcgacagc
cacgcctttgaaatgacggtgctggccttgcggctctcgtgctgggccaacggcgtcagc
cgcctccacggcgtggtgtcgcgccacatgtggaataatctgtggaagggcctgcccacg
gccgaaacccccatcgggcatgttaccaacggtgtgcatacgccgtcctatgtgggcagc
tggatgcacgaactgctgcataaacatctgggcgcgggctggttgcaggcgctgcccggc
tccaccgtgtgggacaaggtggacgacatccccgacgaggctttctgggcagcgcggcag
catcagaaagaagccctgctcgatgccctgcgcaagcgcattcccgtttttgcgcaacgc
ttcaaactggacgccgccgttcgtaaaagaatggaagccctgctgcggcccgaaaccctc
attatcggctttgcccggcgtttcgcgccttacaagcgggccaccctgctctttgccgat
cccgaccgcctggcccgcatactcaacaatccccaccgccccgtggtgcttgttttttcc
ggcaaggcgcacccggcggacgaagcgggcatcaatctcattcaggaagtcatgcgcatg
tgccaggacgaacgctttctcgggcgcatattctttctggaaaactacagtctttcggta
tcgcgcatcatgtcccagggctgcgatgtctggctcaacacaccccggcgtccgcacgag
gcctccggcacaagcggcatgaagctgcccgtcaacggcggcatcaatctgagcatctct
gacggctggtggtgcgaaggctataacaggcagaacggatggaccatcggcccggtcgtc
accaccgaactgcccagcaatgagcagaacgactatgcagacgccgaggccctgtacaac
ctgctggaaaatgccgtgttgccgctctacttcgaccgcacccagggcgacctgccgacc
cagtggatcgccatggccaaacggtcgttcaaaagccttacggccatgtacggcagcaac
cgcatgctcaatgattatatccgccagtattacctgcgggctgcgcgccgccgcaacatg
ctggccgaaaacgactggtcggcatgccgccgccttgccgcctgggaaaaggacctgccc
gcccgcttcggcacggtcaaggtagaggaacttttcatcagcggcgtggaaaacaataca
atgatctgcggcgagccggtaagtgtgcgcctgcatatgcacctgggcgaaatgcagccg
gaagaaatactcgtacagcttgtcatcggccgcgccctggttaacggcagtttcattgac
aagcccgaaatactgcgccttgagccgcgcgcagccgaccacaacggcgaaagcggaaac
ggcatgaactatgccgccacctacattcccacccacagcgggcaataccgctacggcgtg
cgggtgctgccctaccacaaaaatctggcaacaccgcttgaaacaggacttgtgctgtgg
gcctga

DBGET integrated database retrieval system