KEGG   Delftia sp. Cs1-4: DelCs14_2098Help
Entry
DelCs14_2098      CDS       T01497                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
del  Delftia sp. Cs1-4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2373209..2378545
Genome map
AA seq 1778 aa AA seqDB search
MLSGQSAIAAAGQAPASLVEHLRGLAQQRPDDIWLTVAAVQDGRVVERSHSYGEFDRRVR
ALAAGLQQLCPVGARALVMMDNDEHYAASMLACFYAGVIAVPVPPLESLRVQHLERLLGI
VGDADAACVISTAEVMQALPGADARFASIAAVAADQVDLADADAWRPHAPAADDIAFLQY
TSGSTSAPKGVMVSHGNLIANEAAIQQRMDIGAGDRFMSWAPLYHDMGLIGGLLQPLYSG
LPLVLTSPRLFLESPVRWLELISRHRATISGGPDFAYRMCLERIKPSQLAQLDLSSWRLA
YTGAEPVRADTVTAFAQRFAACGLRPDAAYACYGLAEATLFITGGSCGAGATITSFDTEA
LAQGRAEESSCASQTTPLVGCGPAVPGHVVAIVEPHSLQVLEPGRVGEIWAHGPSISQGY
WGKPQQTQQAFVEHAGRRWLRTGDLGFVHGGQVHVAGRIKDLIIVRGHNLYPQDIERVVE
AEVEAVRKGRVAAFAVEGPAGEGIGVAAEISRGLQKLVPRETLVDALAAAVATAFGEAPA
VVVLLEPGALPRTSSGKLQRQACKKGWAQRSLDAYAVWEHGAFVDATESAANDGADQSAP
PPLDATETALAMLWCEVLRRAELPAGDPQFFLLGGNSLSAVQLAARVSQQWGVDFAPGLL
FDRPRLSACAAALRELQAAGPGTGIPRPGPVARGPGASQPLSHAQQRQWFLWHLDPAGTA
YHVTVELQLGGTLDAQRLHTALERLVARHDALRTVFLPAADGSARQHVLDSGGLEFQWLD
LDHEPQRAHEEARRLHARPFDLGKGPLLRALLMRLGPDDHRLVLVMHHIVCDGVSLQNLL
DELAQQYLHLGDAAAAAEPAAPALQYADYAAWHAAWLDGGVRERQLAYWRGQLGSEHPVL
ALPSDRPRAAVARYSAARHGFALPAPLVDALRARAAEAGASLFMVLLAGWQAVLHRHTGQ
QVLRLGVPVAGRQHAGTQGLIGFFVNTLVLQAEVDGRTPLAQVLNAARRATLQAQEHQDL
PFEQLVEDLQPQRSLAHPPLFQLMFNHVHEDLRGFERMTGCMAEAASMPGGTAQFELSLE
VRERAGGAVRVGMDYAAELFLPATMERLGQHYLRMLEALAHHPEATVGEVDLLSDEERAQ
LASWQTGQGGQGGHAVPELVHAAFEQQARRNPQATALVFGEDSWSYGELNARANRLAHHL
IALGVRPEVQVGIAMERSLEMVVGLLAILKAGGAYVPMDPEHPAERLRYMADDSGIGVLL
TQSGLVARLPPALQPLCLAVDAIDLSSCPAHDPGVALHGENLVYVIYTSGSTGRPKGAGN
RHRALCNRLAWGQQHQPLAAQDTVLQKTPFSFDISFWEFFWPLSTGARLALAGPGEHRDP
ARIAALVERHAVTCIHFVPSMLQAFLSSGHAPSCTGLKHIVCSGEALPAELRDRALALLS
GARLLNLYGPTEAAIEVTYHDCREPGPQAVPIGRPLGNVQVHIVDAGLQPVPRGVAGELL
LGGLALARGYWGRPALTAERFVASPSALAGERAYRTGDLVRWNEQGEIEYLGRLDHQVKI
RGFRVELGEIEAALLAVPGLREAVVVADSAEGGSRLVAYLAGEGAALQDLAALKAQLGRS
LPDYMVPSLFVRLDALPLNSNGKVDRKALPAPAPLPASGDGAQPFEAPEGGVAETIATIW
RELLQLERIGANESFFDLGGHSLLLIRAHRRIEDALGSGLSVIDMFQHPTVATLARRIEA
QRGVGAAQEGLQNQQADERAQRRRAALLGRRGLTEEVN
NT seq 5337 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtggacaaagtgcaatcgcggcagcaggccaggcgccggccagcctggtcgag
catctgaggggactggcgcagcagcggcccgacgacatctggctcaccgtggccgccgtg
caggacggccgcgtggtcgagcgcagccacagctatggcgagttcgaccgccgcgtgcgc
gcgctggctgccgggctgcagcagctgtgccccgtgggcgcgcgcgccctggtgatgatg
gacaacgacgagcactacgccgccagcatgctggcctgcttctacgcgggcgtgatcgcc
gtgccggtgccgccgctggaatcgctgcgcgtgcagcatctggagcggctgctgggcatc
gtgggcgacgcggacgcggcctgcgtgatcagcacggccgaagtgatgcaggccctgccc
ggcgccgatgcgcgctttgcaagcattgccgccgtggccgccgatcaggtggacctggcc
gatgccgacgcctggcgaccccatgcgccggctgccgacgacatcgccttcctgcaatac
acctcgggctccacctcggcgcccaagggcgtgatggtcagccacggcaacctcatcgcc
aacgaggctgccatccagcagcgcatggacatcggcgcgggcgaccgcttcatgtcctgg
gcgccgctctaccacgacatgggcctgatcggcggcctgctgcagccgctgtacagcggc
ctgccgctggtgctgacctcgccgcgcctctttctggaaagccccgtgcgctggctggag
ctgatctcgcgccaccgcgccaccatcagcggcggccccgacttcgcctaccgcatgtgc
ctggagcgcatcaagccgtcgcagctggcgcagctggacctgtcgagttggcggctggcc
tacacgggcgccgagcctgtgcgtgccgacaccgtcacggccttcgcgcagcgctttgct
gcctgcgggctgcggcccgacgcagcctatgcctgctacggcctggccgaagccaccctg
ttcatcaccggcggcagttgcggcgcaggcgccacgatcacgtccttcgataccgaggcc
ctggcgcagggccgggccgaggaaagctcctgcgcctcgcagaccaccccgctcgtgggc
tgcggccccgccgttcccggccatgtcgtggccatcgtcgagccgcacagcctgcaggtg
ctggagcccggccgcgtgggtgagatctgggcgcacggccccagcatcagccagggctac
tggggcaagccgcagcaaacgcagcaggcctttgtcgagcatgcaggccggcgatggctg
cgcacgggcgacctgggtttcgtgcacggcgggcaggtccatgtggcgggccgcatcaag
gacctgatcatcgtgcgcgggcacaacctctacccgcaggacatcgagcgcgtggtcgag
gccgaggtcgaagccgtgcgcaaggggcgcgtggccgcttttgcggtggaggggcctgcc
ggcgagggcataggcgtggccgccgagatttcgcgcggtttgcaaaagctggtgccgagg
gagacgctggtcgacgcactggctgccgccgtggccacggcctttggcgaggcgcctgcc
gtcgtggtactgctggagcccggcgcgctgccgcgcacatcgagcggcaagctccagcgc
caggcctgcaagaagggctgggcgcagcgcagcctggatgcctatgcggtctgggagcat
ggtgccttcgtggacgcaacggaatctgcagcgaatgacggtgcagatcagtccgccccc
ccgccgctcgatgccaccgagactgcgctggccatgctctggtgcgaagtgctgcgccgt
gccgagctgcctgcgggcgatccgcagttcttcctgctgggcggcaactccctctcggcc
gtgcaactggctgcacgcgtgtcgcagcagtggggcgtggactttgcgccaggcctgctc
tttgaccggccccggctttcggcgtgcgcggctgcattgcgcgaactgcaggcggcagga
cccggaactggcatccctcgtcctggccctgtggcgcgcggccccggtgcaagccagccc
ctgtcccacgcccagcagcggcagtggtttctctggcacctggatcctgcgggcacggcc
taccacgtgacggtggagctgcagctgggcggcacgctggatgcgcaacggctgcacacg
gccctggagcgcctggtggcacgccacgacgcgctgcgcaccgtgttcctgcctgccgcc
gacgggtcggcccggcagcatgtgctggatagcggcggcctggagttccaatggctggac
ctggaccacgagccgcagcgtgcccatgaagaggcacgccgcctgcacgccaggcccttc
gacctgggcaagggcccgctgctgcgtgcgctgctgatgcggcttgggccggatgaccac
cgtctggtgctggtcatgcaccacatcgtgtgcgacggcgtatccctgcagaacctgctg
gacgagcttgcgcagcaatacctccatctgggtgatgcggcggcggccgccgagcccgct
gcccccgcattgcaatacgccgactacgcagcctggcatgcggcctggctggatggcggc
gtgcgcgagcggcaactggcctactggcgcgggcaactgggcagcgagcatcccgtgctg
gccttgcccagcgaccggccgcgcgcagccgtggcccgctactcggctgcccggcatggc
ttcgcgctgcctgcgccgctggtggacgcgttgcgcgcgcgtgccgccgaagccggcgcc
agcctgttcatggtgctgctggcaggctggcaggccgtgctgcaccgccatacgggccag
caggtgctgcgcctgggcgtgcccgtggcgggccgccagcatgcgggcacgcagggcctg
atcgggttcttcgtcaacaccctggtgctgcaggccgaggtcgatggccgcaccccgctg
gcccaggtgctcaatgcggccaggcgcgccacgctgcaggcccaggagcaccaggacctg
cctttcgagcaactggtggaagacctgcagccccagcgcagcctggcgcatccaccgctg
ttccagctgatgttcaaccatgtgcatgaggacttgcgcggcttcgagcgcatgacgggc
tgcatggccgaagcggcttcaatgcccggaggcacggcgcagttcgagctgtccctggaa
gtgcgtgaacgcgcaggcggcgccgtgcgcgtgggcatggactatgcggccgagcttttc
ctgcccgccaccatggagcgcctgggccagcactatctgcgcatgctcgaggccctggcc
catcaccccgaggccaccgtgggcgaggtggatctgctgtccgatgaagagcgcgcacag
ctggcgtcctggcagaccggccagggcgggcagggcggccatgccgtccccgagctggtc
catgccgccttcgagcagcaggcgcgccgcaacccgcaggccacggccctggtcttcggg
gaagactcctggagctatggcgaactcaatgcgcgcgccaaccgcctggcccaccatctg
atcgcacttggtgtgcggcccgaagtgcaggtcggcattgccatggagcgttcgctggaa
atggtggtcggcctgctggccatcctgaaggccggcggcgcctatgtgcccatggacccc
gagcacccggccgagcgcctgcgctacatggccgacgacagcggcatcggcgtgctgctg
acgcagtcgggcctggtcgcacggctgccgcccgcgctgcagccgctgtgcctggcggtg
gacgccatcgatctgtcctcctgtccggcccatgacccgggcgtcgcgctgcacggcgag
aacctggtctacgtcatctacacctcgggctccaccggccgccccaagggcgcgggcaac
cgccaccgcgcgctgtgcaaccgcctggcctggggccagcagcaccagccgctggccgcg
caggacaccgtgctgcagaagacgccgttcagcttcgacatctcgttctgggagttcttc
tggccgctgtccacaggcgcccggctggcgctggctgggcccggggagcatcgcgatcct
gcgcgtatcgcggccctggtcgagcgccatgccgtcacctgcatccacttcgttccgtcc
atgctgcaggcctttctgtccagcggccatgccccgtcctgcaccgggctgaagcacatc
gtctgcagcggcgaggccctgccggccgagctgcgcgaccgcgcactggccctgttgtcg
ggcgcgcgcctgctcaacctctacggaccgaccgaagccgccatcgaggtcacctaccac
gactgccgcgagcccggaccgcaggccgtgcccatcgggcggccgctgggcaacgtgcag
gtgcatatcgtcgacgctggcctgcagcccgtgccgcgcggcgtggccggcgagctgctg
ctgggcggcctggcgctggcgcgcggctactggggccggcccgcgctcacggccgagcgc
tttgtggccagcccttcggcgctggccggcgagcgtgcctaccgcacgggcgacctggtg
cgctggaacgagcagggcgagatcgagtacctgggccggctggaccaccaggtcaagatc
cgtggcttccgcgtggaactgggcgagatcgaagccgccctgctggccgtgccaggcctg
cgcgaggcggtggtggtcgcagactctgccgaaggcggcagccggctggtggcctacctg
gccggtgaaggtgccgcgctgcaggacctggctgcactcaaggcgcagctgggccgcagc
ctgcccgactacatggtgccctccctctttgtgcgcctggacgcgctgccgctcaacagc
aacggcaaggtggaccgcaaggcgctgccggcgcccgcgcccctgcctgcatcgggcgat
ggtgcgcagccgttcgaggcgcccgaaggcggtgtggccgagaccattgccaccatctgg
cgcgagctgctgcagctcgaacgcataggcgccaacgaaagcttcttcgacctgggcggg
cattcgctgctgctgatacgcgcgcaccggcggatcgaggatgcgctgggcagcgggctt
tctgtgatcgacatgttccagcacccgaccgtggccacgctggcccgccgcatcgaggcg
cagcgcggcgtgggggcggcgcaggaagggctgcagaaccagcaggccgacgaacgcgcc
cagcgccgccgcgccgcgctgctgggccgccgtggtctgaccgaggaggtgaactga

DBGET integrated database retrieval system