KEGG   Drosophila erecta: Dere_GG13352Help
Entry
Dere_GG13352      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
der  Drosophila erecta
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dere_GG13352
   00650 Butanoate metabolism
    Dere_GG13352
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dere_GG13352
   00280 Valine, leucine and isoleucine degradation
    Dere_GG13352
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dere_GG13352
Enzymes [BR:der01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Dere_GG13352
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Dere_GG13352
Amino acid related enzymes [BR:der01007]
 Aminotransferase (transaminase)
  Class III
   Dere_GG13352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MRSLWLNTLTKQGLYRLSTKRYSTSIEPKEPVVKTKSIPGPKSIELKKQLDSVQATGTIQ
FFADYEKSIGNYIYDVDGNILLDVYTQISSVPLGYNHPRLYKVFNNEQNLKTLINRPALG
VFPGKEWPEKLHSVLLNIAPKGLNKITTMMCGSCSNENAYKSIFIWYQNKLRGNTPLTEQ
EKNSCMINIPPGAPNLSILSFKGAFHGRTLGALSTTHSKYIHKLDVPSFDWPIASFPEYR
YPLDENVAHNKKEDEKCLSEVQDLIQQYASKSPVAGIVVEPIQSEGGDNEASPEFFRSLQ
AICKKNGIALLIDEVQTGGGSTGKFWAHEHFELESPPDVVTFSKKLQLGGYFHNDDFIPN
EPYRIFNTWMGDPGKVLLLEEVVKVIQEEKLLANVDVAGKVLKNGLLSLEKEFPHILNST
RGRGTFLAVNCTNTKVRDQIIGALKLHGIQTGGCGEISIRFRPALIFKEYHANIVLDRFR
KVLQAI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcggagcttgtggctgaatacgttgaccaagcagggtctatataggttgagtaccaag
aggtactccaccagcattgagcccaaggaacctgtggtgaaaactaaatcaatacctggc
cccaaatcaattgagcttaaaaaacaactggattctgttcaggccaccggaaccatccaa
ttctttgctgactacgaaaagtccattggaaattacatctacgacgtggacgggaatatt
ctactcgatgtctacactcagatttcctcagttccgctgggttacaaccatccgaggctt
tacaaggtcttcaacaatgagcaaaacctgaaaactttgattaacagacctgcacttggc
gtcttccctggcaaggagtggccagaaaaactacactcagttctgctgaacattgctccg
aaaggactcaataaaatcacaacgatgatgtgtggttcgtgttcaaacgaaaatgcatat
aagagcatcttcatatggtaccagaacaaacttcgtggcaatacacctcttaccgagcag
gagaagaattcctgcatgattaatattcccccaggagctccaaatctcagcattctctcg
ttcaagggggctttccatgggcgaacattgggagccctctccaccacacattccaagtac
atccataagctggacgttccatcctttgactggcccatcgcctcgtttcccgagtaccga
tatcccttagacgaaaacgtggcgcacaacaagaaggaggatgaaaagtgccttagcgaa
gtgcaggatcttattcagcagtacgctagcaagagtccggtcgccggaattgtggttgaa
ccgattcaaagtgaaggaggcgacaacgaggcatcgcccgagttcttcaggagcctccag
gctatctgcaagaagaatggcatcgccctgttgatcgatgaggtccaaaccggaggaggt
agcactggaaaattctgggcccacgagcacttcgagttggagagtccgcccgatgtggtg
accttcagcaagaagctgcagttgggtggctacttccacaacgacgacttcattccgaat
gagccgtacaggatcttcaacacctggatgggcgatccgggtaaggtcctgctcctcgag
gaagtcgtgaaggtgattcaggaggagaagctcctggccaatgtcgatgtggcaggcaag
gttctaaagaacggtctgttgagtctggagaaggaattcccgcatatcttgaactccacc
cgtggtcgtggaacatttttggcggttaattgcaccaacaccaaggtgcgagatcaaata
atcggcgcactgaagttgcacggcattcagaccggaggctgtggagaaatttccattaga
ttccgcccagctttgatatttaaggaatatcacgctaacatcgtcctagaccgcttccgc
aaagttcttcaagctatttaa

DBGET integrated database retrieval system