KEGG   Drosophila erecta: Dere_GG23393Help
Entry
Dere_GG23393      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform B
Organism
der  Drosophila erecta
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 6543110
NCBI-ProteinID: XP_001970405
FlyBase: FBgn0115541
UniProt: B3N851
LinkDB All DBs
Position
Unknown
AA seq 70 aa AA seqDB search
MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNP
FREKSSCTVL
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggacgtaatgtcatcatccctgcagcagcagcgcgtcgtggtggagcagctgcgtcgc
gaggcagccatcgaccgccagacgatctcggagtcgtgcgccaagatgatgaagtacatc
acggagcacgagcaggaggactacttgctcaccgggttcaccagccagaaggtgaatccg
ttccgcgagaagtcatcgtgcaccgtcctctaa

DBGET integrated database retrieval system