KEGG   Drosophila erecta: Dere_GG23898Help
Entry
Dere_GG23898      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dere_GG23898
Peptidases [BR:der01002]
 Metallo Peptidases
  Family M2
   Dere_GG23898
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dere_GG23898
CD molecules [BR:der04090]
 Proteins
  Dere_GG23898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 693 aa AA seqDB search
MHSVLALGCLCLSLTLSFASPQLNLPTPQPEVFYNGYTPNVATTPAQLRADRDRDQRYGP
PYSDAGRGGGIDDGLDDFRFGQTDDERMRIGYAYPSPRVNFSDSPFSGARFSNHNYGPIS
STSTTDRNYGNDANLNGRYSDVPYSAQGERNLNPSDQYNYNNNPNVEFVGINNRNRFENP
FLSNQDRFNLNQGYLERQRYQQDRRYQQELEKLRILLVESDQKGSLECTANVAAQWNFET
NVNDFTQTEALNAQQRYVEFQRITAEQSKRVNKDLILDRRLYRQLMLQSEVGPNALPLDV
LDRYNRLLNEMLFLYNSAGICAYQQPFQCDLHYIPQLKDIMAKSRDWDELQHTWVEYHRK
AGRGMRDSYEQLIDVMQEVAYVNNVTNGGEYWYLAYESGNFRQDMDIVWEQIRPLYEGLH
AYVRRKLRDYYGPDRINRIAPIPSHILGNMYGQSWSNVLDILIPYPGRKLIDVTPRMVEQ
GYTPQLMFQLAEEFFTSINMSAVGPEFYRNSIFEQPLDRRVLCEPSAWDFCNRHDFRVKI
CTDINQRSLISVHHEMAHIQYFLQYRHLPKIFRNGANPAFHQAVGDAIGLSVSTPRHLQT
LGLLQRSLDESSYDINYLFTMAIDKVAFLPFALSLDNWRYDVFSGNANKRTMNCHYWNLR
EKYSGIKPPVLRSEKDFDPGAKYHIPANIPYIK
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtgttttggctttgggctgtctgtgccttagcctgactttgagcttcgccagt
ccccagctgaatctgcccacccctcagcccgaggtcttctataatgggtacaccccgaat
gtggccaccactccggcccagcttcgagcggatcgggatcgcgatcagcgctacggacca
ccttactccgatgcgggaagaggtggcggcatcgacgacggactggacgactttaggttc
ggccagacagatgacgagcggatgaggatcggctatgcctatccctcgccccgcgtgaac
ttcagtgactcacccttcagtggggctaggttctccaaccacaactacggacccatttcc
agcaccagcaccaccgatcgtaactacggcaacgatgccaacctcaatgggcgctattcg
gatgtgccctactccgcccagggagagcgtaaccttaatcccagcgatcagtacaactac
aataataatcccaatgtggaatttgtgggcatcaacaatcgcaatcgcttcgagaatccc
ttcctttcgaaccaggatcgtttcaacctaaatcagggatacctggagcgtcagcgatat
cagcaggatcgccgctatcagcaggaactggagaagctgcgcatcctgctggtggagtcg
gaccagaagggatctctggagtgcaccgccaatgtggctgcccagtggaacttcgagacg
aacgtgaatgattttacccaaacggaagcgctgaatgctcaacagaggtatgttgagttc
cagcgcatcactgccgagcaatccaagcgagtcaacaaggacctcatcctcgaccgtcgc
ctctacagacaactgatgctccagtcggaagtgggacccaatgctctgcccctagatgta
ttggacaggtacaatcgcctgctcaatgagatgctgttcctgtacaacagcgccggaatc
tgtgcctaccagcagccctttcagtgcgatcttcactacataccccagctgaaggacatc
atggctaagagcagggattgggatgaactgcagcacacttgggtggaataccacaggaaa
gcgggacgcggaatgcgggatagctatgagcagttgatcgatgtgatgcaggaggtggcc
tacgtaaacaatgttaccaatggcggggagtactggtatctggcctacgagtcaggtaac
ttccgtcaggatatggatattgtttgggaacagataagacctctttacgaaggattgcat
gcgtacgttcgccggaagctaagggattactatggtccagatcggataaaccgcattgca
cccattccctcgcacattctgggcaacatgtacggccagtcgtggtccaatgtgctggac
attttgataccctatccaggccgtaagctgatcgacgtcactccgagaatggtggagcag
ggctatacacctcaactgatgttccagctggccgaggagttcttcacctccatcaacatg
tccgcggtgggtccggagttctatcgcaactccatattcgaacagcccctggaccgaagg
gttctgtgtgagccatccgcctgggacttttgcaatcgtcacgacttccgggttaaaatc
tgtacggatattaaccagcgcagcttgattagtgtgcaccatgagatggcgcacattcaa
tactttctgcagtaccgtcacctgcccaagatctttagaaatggagcaaatccggcattt
caccaggcggtgggcgatgccattggactgtccgtatccactccaaggcatttgcagacc
ctgggacttctgcaacgatccctcgacgagtccagctatgatataaactatctgttcacc
atggccattgataaggtggcatttttacctttcgcattatctctggacaactggcgatac
gatgtctttagtgggaatgcgaataaacgtacaatgaactgtcactactggaatctacga
gaaaagtattccgggataaagcctccagttctgcgatcagaaaaggacttcgacccggga
gccaagtaccatattccagcaaacattccctatatcaagtga

DBGET integrated database retrieval system