KEGG   Desulfuromonas sp. DDH964: DBW_2858Help
Entry
DBW_2858          CDS       T04368                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
deu  Desulfuromonas sp. DDH964
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:deu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DBW_2858
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DBW_2858
Enzymes [BR:deu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DBW_2858
Peptidoglycan biosynthesis and degradation proteins [BR:deu01011]
 Precursor biosynthesis
  Racemase
   DBW_2858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3032311..3033447)
Genome map
AA seq 378 aa AA seqDB search
MPLRPTFAEIDLDALRHNFRLLRRQAGAGRQLLAVVKADAYGHGALPVARTLQACGADYF
GVAMVAEGTALRQGGIQRPILVLGGAAPGEEALLLDQNLTPVIFDLPAARRLSAAAMAAG
RSCRYHLKVDSGMGRLGFVPADLPAVLPRLADLPGLEMAGLISHFALADQADHPITQTQA
ERFRAMLGTVRAAGFAPALVHLSNSAGLYGPALPDCNLVRPGIALYGGLPADYLAGEIDL
RPVMRLYTTIAQLTAVPPGAGVSYGHRFVASRPTLIAALPVGYADGYARRLSGCGEVLVR
GHRAPVAGTVCMDWTMVDVTDVPAVAVGDRVTLLGRDGSEEVTAEEWAGRIGTISYEVFC
LISQRVPRVYLNPEPGPA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcccctacgacctaccttcgccgaaatcgatcttgacgccctgcgccataacttccgc
ctgcttcgtcgccaggccggggccggccgccagctgctggcggtggtcaaggccgacgcc
tacggccatggcgccctgccggtcgcccggaccttgcaggcctgcggcgccgactatttt
ggcgtcgcgatggtggcggaggggaccgccctgcgccagggggggattcagcggccgatc
ctggtgctggggggcgccgcgccgggtgaagaagcgctgctgttggaccagaatctcacc
ccggtgattttcgatctgcccgcggcccggcgcctgagcgcggccgccatggccgccggg
cgtagctgccgctatcacctcaaggtcgattcggggatggggcgcctcggtttcgtcccc
gccgacctccccgcagtcctcccccggctcgccgacctccccgggttggagatggcgggg
ctgatctcccatttcgccctcgccgaccaggccgatcaccctattacccagacccaggcg
gaacggttccgcgcgatgctggggacggttcgcgccgccggtttcgctcccgctctcgtc
catctcagcaacagcgccggactctatggcccggctttgcccgactgcaacctggtgcgc
ccggggattgccctttatggcggcctgccggccgactacctggcgggagagatcgacctg
cgcccggtaatgcgcctttacaccaccattgcgcagctcacggcggtccccccgggcgcg
ggggtctcctatggccaccgctttgtggcgagtcggccgaccctgatcgccgccctgccg
gtcggctacgccgacggctatgcccggcgcttgtccggctgcggcgaggtcctggtccgg
gggcaccgggcgccggtggccggtaccgtctgcatggactggacgatggtcgatgtcacc
gatgttcccgccgtagcggtcggcgaccgggtgacgctcctcggtcgggacggctccgaa
gaggtcaccgccgaggaatgggccgggcgcatcggcaccatcagctacgaagtcttctgc
ctgatcagtcagcgggtgccgcgcgtctatctcaacccggaaccgggcccggcctga

DBGET integrated database retrieval system