KEGG   Dehalococcoides mccartyi VS: DhcVS_754Help
Entry
DhcVS_754         CDS       T01136                                 

Definition
(GenBank) hypothetical protein
Organism
dev  Dehalococcoides mccartyi VS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
703159..703713
Genome map
AA seq 184 aa AA seqDB search
MPSNPLEEYNRKRNFAKTAEPSGVRSTLSVQPVFVVQKHLASRLHYDFRLEIDGVLKSWA
VPKGPSASPKEKRLAVPTEDHPMQYASFEGVIPAGEYGAGQVIVWDRGTFTNLKTGKTLA
ESYDTGHLVIELQGEKLKGGYSLLRTKMGWLMVKMEDAFARPLSDILDEQPASVISGKLV
ENIT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaccctctggaagaatataaccgcaaacgtaattttgctaaaactgctgaa
ccttctggtgtacgaagtacactctctgtacagcccgtatttgttgtccaaaaacacctt
gccagccgcctgcactatgatttcagactggaaattgatggggttttaaaatcatgggct
gttcccaaagggccgtctgccagccccaaagaaaaacggctggctgtgcctaccgaagac
catcccatgcagtacgcctcttttgagggtgtaataccggcgggtgaatatggggcgggg
caggtgatagtctgggataggggcacttttacaaaccttaaaacaggaaaaacactggca
gagtcttatgacacaggacatctggtaatagaacttcagggtgaaaaactcaaaggcgga
tattcgcttttacggactaaaatgggctggctgatggtgaagatggaagacgcatttgcc
cgcccgttgtccgatatacttgatgaacaaccggcttcggtgataagcggaaaattggtt
gaaaatattacttaa

DBGET integrated database retrieval system