KEGG   Cavenderia fasciculata (cellular slime mold): DFA_12097Help
Entry
DFA_12097         CDS       T02668                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    DFA_12097 (sod2)
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DFA_12097 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 250 aa AA seqDB search
MISRFTSTNLLRGAVRYYGSTSTSYTLPDLPYDYKALEPVIAGEIMEIHHKKHHQAYVTN
LNASLEKYAAAESAKDVAAMIGLQSAIKFNGGGHVNHSIFWTNLAPKNAQGGVSPSGPLA
DAINQQFGSLEKFIEKFNAQTVAIQGSGWGWLGYDKANSKLVISSCANQDPLSTIGLTPL
LGIDVWEHAYYLQYKNARADYLKNIWQIVNWSNVAERYSKAKRLKHIHDKIAFNLVNLLY
SIHWMDNRIE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgattagtagatttacatcaaccaaccttttaagaggtgcagtcagatattatggctca
acatcaacctcttacacattgccagacctcccatacgactacaaagcacttgaaccggtc
attgccggtgagatcatggagattcatcacaagaagcatcaccaagcctacgtcaccaac
ttgaatgcttctcttgaaaagtatgctgctgcagagtctgccaaggacgttgctgccatg
attggtctccaatctgccatcaagtttaacggtggtggccatgtcaatcacagcatcttt
tggactaaccttgctccaaagaatgctcaaggtggtgtatctccatctggtccactcgct
gatgccattaatcaacaatttggttcacttgaaaagtttattgaaaagtttaatgctcaa
actgttgccattcaaggttcaggttggggttggttgggctatgacaaggctaatagcaag
cttgtcatctctagctgtgccaatcaagatccactctctaccattggtttaactccactt
ttgggtattgatgtctgggaacatgcttactatcttcaatacaagaatgctagagctgac
tacttgaagaacatttggcaaattgttaactggagtaatgttgccgagagatactcaaag
gcaaagagattaaaacatattcatgataaaatagcctttaaccttgtcaatttattatat
tccattcattggatggataatagaattgaatag

DBGET integrated database retrieval system