KEGG   Desulfotomaculum ferrireducens: B0537_08295Help
Entry
B0537_08295       CDS       T04823                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dfg  Desulfotomaculum ferrireducens
Pathway
dfg00030  Pentose phosphate pathway
dfg01100  Metabolic pathways
dfg01120  Microbial metabolism in diverse environments
dfg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B0537_08295
Enzymes [BR:dfg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     B0537_08295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AQS59079
UniProt: A0A1S6IWC5
LinkDB All DBs
Position
1690146..1691993
Genome map
AA seq 615 aa AA seqDB search
MNGYGGNILRINLTQGDIKVQPLDETMAREWIGQRGFIAKILWDELKPGIDPLGPDNLLV
MSTGPLAGTLVPAGGKVSFGAKSPATGIYGESCMGGHIAAEMKYAGYDIIILEGMAAKPS
YIYIEDDKIEIRDASHLWGKGAIQAEKLLKEELGDDFQICTIGPAGEKVVKYACISHDFG
RQAGRTGMGTVMGSKNIKAIAICGSKSIPLADMASAVAKGKEMLKGCFAKENLDEWQDYG
TAGVPVWANKIGAFPTKNFQSSYLEGNEALDGKIMREKMVINDKGCFGCPSPCGKYCYVK
EYNVYTEGPEYETTALIGGNCVFTDIEQVGYLNYLCDEMGLDTISTGNVIGFAMECFEKG
ILTAEQVGREIKFGDVASFKYLVEQITARQGIGDILAEGVKYAAERFGGDSIKFAIQIKG
LEWSGYESRSAPSNMLAYMTCDLGAHHSRAWSVTHDIAVGRKVLEGKAQKVVELQHIRPF
FDLIGCCRLQWVEIGFELEHYPEVFRYITGFDYSQEDLMKISEKVWNLTRAFAWREIVDF
GRKYDYPPARFYEEAVTTGPNAGDTLSKEALEYLLDDYYNLRGWDKNGLPTKEKLLQLGL
GFVVQELEAMERKLA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaacggttatggcggtaatatcttacgcattaatctcacccagggagacataaaagtt
caacctttggatgaaacaatggctcgggaatggattggtcagagggggtttattgccaaa
attctttgggatgaattaaaacccggcattgatcctctgggaccggacaatctcttagtt
atgtccaccggacccctggcaggcaccctggtacctgccggcggtaaagtaagttttggt
gctaaatctccggccaccggcatttacggtgagagttgcatgggtggtcatatagccgcg
gaaatgaaatatgctggttatgacattattattttagaaggtatggctgccaaaccaagc
tacatttatatagaagacgacaaaatagaaatacgggacgcctcccacctctggggtaag
ggggctatacaagctgaaaagctcttaaaggaagaactgggtgatgattttcaaatctgt
accatcggaccggcaggggaaaaggtggtaaaatatgcttgtatttcccacgattttggt
cgtcaggctggacgtaccggcatgggtacggtaatgggtagtaaaaacattaaagccatc
gccatttgtggcagtaaaagcattcccctggcagatatggctagcgctgtagctaaaggc
aaggaaatgttaaagggctgttttgccaaagaaaacctggacgaatggcaggattatggc
accgctggtgttcctgtctgggctaataaaattggtgctttccccaccaaaaactttcaa
tcttcctatttagagggtaacgaagccctggatggtaagatcatgcgtgaaaaaatggtg
atcaatgacaagggatgctttggttgccccagcccctgcggtaaatactgctatgttaag
gaatataatgtttataccgaaggaccggaatatgaaaccactgccctaattggtggtaat
tgtgtatttaccgatattgagcaggtggggtatctaaactatctttgcgatgaaatgggt
ctggacactatctccaccggtaatgtcattggttttgccatggagtgctttgaaaagggt
attttaaccgccgaacaggtgggacgagaaataaaatttggtgatgtggccagctttaaa
tatttggtggagcagattaccgctcgtcaaggcattggtgatatactggcagaaggtgtt
aaatacgccgccgagaggtttggcggagactcgataaaatttgctatccaaattaaaggt
ttggaatggagtggctatgaatcccgcagtgccccatccaatatgctggcctatatgact
tgcgatctaggtgctcatcacagccgtgcttggtcagttacccatgacatagctgtgggc
aggaaggtactggagggtaaggcccaaaaggttgtggaactgcagcatattcgtcccttc
tttgatctcattggctgctgccgtttacaatgggtggaaatcggctttgaattggaacat
tacccggaggtgttccgttatattactggtttcgactactcccaggaggatctcatgaag
atatccgaaaaggtttggaatctaaccagagcctttgcctggagagaaattgttgatttt
ggtagaaaatacgactatccaccggcccgtttttatgaggaagcagtgaccaccggcccc
aacgccggggataccctaagcaaagaggctttagagtatttattggacgattattataac
ttacggggctgggataaaaacggtctgcccaccaaggaaaaactgctgcaattgggtcta
gggtttgtggtacaggaactggaggcaatggaaagaaagctggcctag

DBGET integrated database retrieval system