KEGG   Dehalogenimonas formicexedens: Dform_00706Help
Entry
Dform_00706       CDS       T04654                                 

Definition
(GenBank) DNA ligase D, 3'-phosphoesterase domain-containing protein
Organism
dfo  Dehalogenimonas formicexedens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
660041..660616
Genome map
AA seq 191 aa AA seqDB search
MAEEKLREYTEKRNFKKTAEPPPEVKLPSAKPMFVIQKHDASRLHYDLRLEVDGVLKSWA
VPKGPSLDPQAKHLAVPTEDHPMAYGGFEGTIPQGEYGGGTVMVWDTGTYRNIKADKPEP
ETMAEAYDKGRIEVFLEGKKLRGLFALIRTAKGWLFFKMNDEFVKAGDILEESPDSALTG
RTLSQIAAAEA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaaaattaagagaatacaccgaaaagcgcaactttaaaaagaccgccgaa
cctccgcctgaagtaaagctgccttcagccaagccgatgttcgtcatccaaaaacacgat
gcttcccgccttcactatgacctcaggctggaagtcgatggggttttgaaaagctgggcg
gtaccgaaaggtccctcccttgatccccaagccaagcacctggcggtgccgaccgaggac
caccccatggcgtacggcggatttgaaggaaccatcccccagggggaatacggcggcggc
acggtgatggtctgggacacgggcacataccggaacatcaaagccgataaaccggaaccg
gaaacgatggcggaggcctacgataagggcaggatcgaggtatttctcgaaggaaaaaag
ttgcgaggcctttttgccctgatccggaccgccaaaggttggctcttcttcaagatgaac
gatgaattcgtgaaagccggggatatccttgaagagtcccctgattccgcccttacggga
aggactctctcccagatcgcggctgcggaggcttag

DBGET integrated database retrieval system