KEGG   Deinococcus geothermalis: Dgeo_1886Help
Entry
Dgeo_1886         CDS       T00353                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dge  Deinococcus geothermalis
Pathway
dge00010  Glycolysis / Gluconeogenesis
dge00020  Citrate cycle (TCA cycle)
dge00620  Pyruvate metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
Module
dge_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_1886
   00020 Citrate cycle (TCA cycle)
    Dgeo_1886
   00620 Pyruvate metabolism
    Dgeo_1886
Enzymes [BR:dge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dgeo_1886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 PYNP_C GCV_H HlyD_D23 DUF2254 RnfC_N NQRA HupF_HypC
Motif
Other DBs
NCBI-ProteinID: ABF46181
JGI: Dgeo1886
UniProt: Q1IX53
LinkDB All DBs
Position
complement(1981731..1983515)
Genome map
AA seq 594 aa AA seqDB search
MATELKLPDVGDNIEQGTVVTVLVKPGDQITEGQPVIEIETDKAVVEVPASAGGIVEAVQ
VKVGDSVKVGDVLLTLAGTGAAAAPASAPGSTPVAPSAEAESSAVASDPAVANRVAQGQQ
AAQKAQAASGSQPQAPVGQPSEQAGGTAQVTLPDVGDNIEQGTVVTVLVKPGDQITEGQP
VIEIETDKAVVEVPSSAGGTVQDVRVKVGDSVKVGDVLLTLVGQTGTTQDQGAQAPASQP
APAAPASRPVQPPAQGALEPGSLTPTAPTQASGAQRPYNTQTYDGRPVIPAAPSVRRLAR
ELHVNIQAVHGTGIAGRISEEDVRRAAGTPSVQAPAAQAAPTTAAPAPAAAAQPLPDFTK
WGPVRREDMSGIRKATVRSMTQSWTTIPMVTHFDKADVTRMEEVRKAFAPRVEKAGGKLT
MTHILMKVVANALRKFPKFGASLDLEHQQVIYKDYVNLGVAVDTPQGLLVPVLKDADRKS
ITEIVLELSELAAKARDRKLSPSEMQGATFTISNLGGIGGTGFTPIVNAPEVAILGVSRG
GFEPVWNKETGSFEPRNMLPLSLTYDHRLIDGADAARFLRYISEALEDPFLISL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagaactgaaacttcccgatgtgggcgacaatatcgagcaggggacggtcgtc
acggtgctggtgaagcccggcgaccagatcacagaagggcaacccgtcatcgagatcgag
accgataaggcggtggtggaagtcccggccagtgcaggggggatcgtcgaggcggtgcag
gtgaaggtgggagacagcgtgaaggtgggcgacgtgctcctgacgctggccggcactggg
gctgcggcggcgccggccagtgcccccgggagcaccccagttgccccatccgccgaagcg
gaaagcagcgctgttgcgtccgatcccgctgtggccaatcgcgtcgcgcaggggcagcag
gccgcacagaaggcgcaggcagcgtccggcagccagccgcaggccccggtgggtcagccc
tccgaacaggcgggcggcaccgcccaggtcactctccccgacgtgggcgacaacatcgag
caggggacggtcgtcacggtgttggtgaagcccggcgaccagatcacggaagggcagcct
gtcatcgagattgaaacggacaaggcggtcgtcgaggtgccctccagcgcgggaggaacc
gtgcaggacgttcgggtgaaggtgggggacagcgtgaaggtgggtgacgtgctcctgacg
ctggtgggccaaacgggcacgacccaggatcagggtgctcaagcgcctgcgtctcagccg
gcgcccgccgcgcctgcgtctcggccggtgcagccgcccgcccaaggcgcattggaaccc
ggcagcctgacaccgaccgccccgacgcaggcctcgggtgcccagcggccctacaacacc
cagacctacgacggccgcccggtgattcccgctgcgcccagcgtgcgccgtctggcccgc
gagctgcacgtgaacattcaagccgtgcacggcaccggtatcgcggggcgcatcagcgag
gaggacgtgcgccgtgcggcggggacgcccagcgtgcaggctcctgcggcccaggccgcg
ccgaccaccgctgctccggctcccgccgccgctgcccagcccctccccgacttcacgaag
tggggtccggtgcgccgcgaggacatgagcggtatccgcaaggcgacggtgcgctccatg
acccagtcgtggacgaccatcccgatggtcacgcacttcgacaaggccgatgtgacccgc
atggaggaggtccgcaaggcgtttgccccgcgggtggagaaggcgggcggcaagctcacc
atgacccacatcctgatgaaggtggtggcgaacgccctgcggaaattccccaagttcgga
gccagcctcgacctcgaacaccagcaggtgatctacaaggactacgtgaatctcggcgtg
gcggtcgacacgccccaggggctgctggtgcccgttctcaaggacgccgaccgcaagagc
atcaccgaaatcgtgctggagctgagtgagctggcggccaaggcgcgcgaccgcaagctg
agcccaagcgagatgcagggggcgaccttcaccatctccaacctcggcgggatcggcggc
actggctttaccccgatcgtcaacgcgccggaggtcgccatcctgggggtgtcgcgcggc
ggcttcgagccggtgtggaacaaggagacgggcagctttgagccccgcaatatgctgccc
ctctccctcacctatgaccaccgcctgatcgatggggcggatgccgcccgcttcctgcgg
tacatcagcgaggcgctggaagacccgttcctgatctcgttgtaa

DBGET integrated database retrieval system