KEGG   Desulfotomaculum gibsoniae: Desgi_3960Help
Entry
Desgi_3960        CDS       T02657                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dgi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desgi_3960
Enzymes [BR:dgi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Desgi_3960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4014253..4016115)
Genome map
AA seq 620 aa AA seqDB search
MIKDRARPICHNAVVNLTEQTVEYMETPQEILKKFVGGRGLNMYYLYKYLKPHADPLSPD
NVLIIGTGLLTGTLSPNSGRYSVTCISPESGIIGDANIGGFFGAEMRFAGIDRLIITGKA
ASPVYLYLENGRVEIRDASAYWGQTCSNTQRKLKVDLGSDVEISCIGPSGESMVRFSSVM
SGVKNAAGRCGTGAVMGSKNLKAIVARGNYGLPIADPKGMINKYIELRNYLKKSKVTQVL
GRVGTPLLYDVSNYLGAIRTHNSQQTVFYDTLNAEKIHKYVDKMLSCYGCIIHCRHRNKL
GGEGPEYTTEVMLGANIGVADTYQMIDLNNIANDLGLDVSSLGTYIAWAIELFEKGYITE
KSVGYPLQFGDYEMARRLIEDIAYRRGFGDTLAEGSRLVSKYGPETADFLIAVKGLPQSD
PHDVRYIKAFSLGIATSSRGADHLRSRPTLEILDLPPDVTERIYGGPVDPNPMSYTSKGR
LVYFSDNIYAVVDSMGICKFACQGFNSPRNLNYNHFCELTKLAVGLEFNKEELEQVGRRV
IDMERLINYTVKGITRKDDTLPARYFDEPMPSARAKGSHIDRQGFDKMLDDYYSLRGWTA
DGRLTPARVAEFEKLRDYLH
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagatagggcaaggcctatctgtcataacgctgtggtgaatttaacggaacaa
acagttgagtatatggaaaccccccaagaaatattgaagaaatttgttggtggccggggt
ctcaacatgtattatctgtataagtatttaaagccccatgccgaccctctgtctcccgat
aacgtgctaattatcggtaccggtttgctcaccggaacattgtcgcctaacagcgggcgg
tacagtgtaacctgcatatcccctgaatccggcataatcggcgatgccaatataggagga
ttcttcggggcggaaatgagattcgcgggcattgacaggctgattataactggcaaggca
gcaagcccggtttacctgtacctggagaacgggcgggtagaaatcagggatgcctcagcg
tattgggggcaaacttgttcaaacacacaaaggaaattaaaggttgacctgggcagtgat
gtggaaataagttgcattggtccgtccggtgaaagcatggtcaggttttcctctgtaatg
tcaggggtgaaaaatgcagccgggcgatgcggcacaggagcagttatgggctcgaaaaat
ctaaaagccattgttgcccgtggtaattacggtctgcccattgccgaccccaagggcatg
atcaataaatatattgaattgcggaactatttgaaaaagtccaaagtgacgcaggtgctg
gggcgcgttggtacgcctttactttatgatgtatccaattacctgggggcaattcgtact
cataacagccagcaaacagttttctatgatacccttaatgcagaaaaaatacacaaatat
gtcgacaaaatgctttcctgttatggttgtatcatacactgccgccaccgtaacaaactt
ggtggtgaaggaccggaatataccaccgaagtaatgcttggcgccaacattggtgtggcg
gatacttaccagatgattgatttaaataatattgccaatgacctgggcctcgacgtatcc
tccttgggtacctacattgcatgggcaattgagctgtttgaaaaaggctatatcactgaa
aaatccgttggttacccgttacagttcggtgattacgagatggccaggcggctgatcgaa
gatatagcatatcgccggggatttggagatacattggctgagggaagccggttggttagt
aaatatggcccggaaactgctgattttttgattgctgtaaaaggattaccccagtctgac
cctcatgatgtacgctatattaaagcattttccctgggcatagctacttcctcccggggg
gcagaccatttacgcagtcgtccgaccctggaaattctagacctgccgccggatgttact
gaaagaatatacggtggaccagtggaccccaacccgatgtcatacacgtccaagggaagg
ttggtttactttagcgataatatatacgccgttgtagactctatgggcatatgtaaattt
gcctgccaggggtttaacagtccgcgaaacttgaattataaccatttttgtgagttaacc
aaactggctgttggccttgaattcaataaagaagaacttgaacaagtaggtcgccgggta
atagacatggaaaggctaattaattatacagttaagggcattaccagaaaggatgatacg
cttccggcccgctactttgacgaaccgatgcccagtgccagggccaagggcagtcacata
gaccggcagggctttgataaaatgcttgatgattactatagcctgcgcgggtggaccgca
gatggtaggctgacaccggcaagagtcgcggaatttgaaaagctgagagactatttacat
taa

DBGET integrated database retrieval system