KEGG   Deinococcus gobiensis: DGo_CA2493Help
Entry
DGo_CA2493        CDS       T01827                                 

Gene name
mdh
Definition
(GenBank) Malate dehydrogenase subfamily
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00020  Citrate cycle (TCA cycle)
dgo00270  Cysteine and methionine metabolism
dgo00620  Pyruvate metabolism
dgo00630  Glyoxylate and dicarboxylate metabolism
dgo00680  Methane metabolism
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01120  Microbial metabolism in diverse environments
dgo01130  Biosynthesis of antibiotics
dgo01200  Carbon metabolism
Module
dgo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dgo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dgo_M00012  Glyoxylate cycle
dgo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DGo_CA2493 (mdh)
   00620 Pyruvate metabolism
    DGo_CA2493 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    DGo_CA2493 (mdh)
  Energy metabolism
   00680 Methane metabolism
    DGo_CA2493 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DGo_CA2493 (mdh)
Enzymes [BR:dgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     DGo_CA2493 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AFD26420
UniProt: H8GS29
LinkDB All DBs
Position
2648920..2649912
Genome map
AA seq 330 aa AA seqDB search
MANKQPVRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEITPALKALGGVVMELR
DCAFPLLADIVVSDDPMVAFKDADYALLVGAMPRKAGMERGDLLGANGGIFKPQGEALNA
VASRDVKVLVVGNPANTNALIAQQNAPDLDPKQFTAMVRLDHNRAVSQLAEKTGQPVSEI
KNMTIWGNHSSTQYPDLSQTTVGGQPALDLVERDWYEQTYIPTVAKRGAAIIEARGLSSA
ASAASAAIDHMRDWALGTREGEWVSMGIPSDGSYGIPEGLIYGFPVRTSGGKYEIVQGLD
ISDFSRGKMDATAQELSEERDEVRKLGLVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaagcaacccgtacgtgtggccgtcaccggcgcggccggccagatcggctat
agcctgcttttccgcatcgcctcgggcgacatgctgggtaaggatcagccggtcatcctg
caactgctggaaatcaccccggccctcaaggcgctgggcggcgtggtcatggaactgcgc
gactgcgctttcccgctgctggccgacatcgtggtcagcgacgacccgatggtggccttc
aaggacgccgactacgcgctgctcgtgggcgccatgccccgcaaggccggcatggagcgc
ggcgacctgctgggcgccaacggcggcatcttcaagccccagggcgaggccctgaacgcc
gtcgccagccgtgacgtcaaggtgctcgtggtgggcaaccccgccaacaccaacgccctg
atcgcccagcagaacgcgccggacctcgaccccaagcagttcacggcgatggtgcgcctg
gaccacaaccgcgccgtatcgcagctcgccgagaagaccggccagccggtgagcgagatc
aagaacatgaccatttggggcaaccactcctcgacccagtaccccgacctctcgcagacg
acggtgggcggccagcctgcgctggacctcgtcgaacgcgactggtacgagcagacctac
atcccgaccgtcgccaagcgcggcgcggcgatcatcgaggcgcgcggcctgagcagcgcg
gcctcggcggcgagcgcggccatcgaccacatgcgcgactgggcgctgggcacccgcgaa
ggcgagtgggtcagcatgggcattccctcggacggcagctacggcatccccgagggcctg
atctacggcttcccggtgcgcaccagcggcggcaagtacgagatcgtgcagggcctggac
atctccgacttcagccggggcaagatggacgccaccgcgcaggaactgagcgaggagcgc
gacgaggtccgcaagctcggtctggtgaagtaa

DBGET integrated database retrieval system