KEGG   Deinococcus gobiensis: DGo_CA2493Help
Entry
DGo_CA2493        CDS       T01827                                 

Gene name
mdh
Definition
(GenBank) Malate dehydrogenase subfamily
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
dgo  Deinococcus gobiensis
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DGo_CA2493 (mdh)
   00620 Pyruvate metabolism
    DGo_CA2493 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    DGo_CA2493 (mdh)
  Energy metabolism
   00680 Methane metabolism
    DGo_CA2493 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DGo_CA2493 (mdh)
Enzymes [BR:dgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     DGo_CA2493 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2648920..2649912
Genome map
AA seq 330 aa AA seqDB search
MANKQPVRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEITPALKALGGVVMELR
DCAFPLLADIVVSDDPMVAFKDADYALLVGAMPRKAGMERGDLLGANGGIFKPQGEALNA
VASRDVKVLVVGNPANTNALIAQQNAPDLDPKQFTAMVRLDHNRAVSQLAEKTGQPVSEI
KNMTIWGNHSSTQYPDLSQTTVGGQPALDLVERDWYEQTYIPTVAKRGAAIIEARGLSSA
ASAASAAIDHMRDWALGTREGEWVSMGIPSDGSYGIPEGLIYGFPVRTSGGKYEIVQGLD
ISDFSRGKMDATAQELSEERDEVRKLGLVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaagcaacccgtacgtgtggccgtcaccggcgcggccggccagatcggctat
agcctgcttttccgcatcgcctcgggcgacatgctgggtaaggatcagccggtcatcctg
caactgctggaaatcaccccggccctcaaggcgctgggcggcgtggtcatggaactgcgc
gactgcgctttcccgctgctggccgacatcgtggtcagcgacgacccgatggtggccttc
aaggacgccgactacgcgctgctcgtgggcgccatgccccgcaaggccggcatggagcgc
ggcgacctgctgggcgccaacggcggcatcttcaagccccagggcgaggccctgaacgcc
gtcgccagccgtgacgtcaaggtgctcgtggtgggcaaccccgccaacaccaacgccctg
atcgcccagcagaacgcgccggacctcgaccccaagcagttcacggcgatggtgcgcctg
gaccacaaccgcgccgtatcgcagctcgccgagaagaccggccagccggtgagcgagatc
aagaacatgaccatttggggcaaccactcctcgacccagtaccccgacctctcgcagacg
acggtgggcggccagcctgcgctggacctcgtcgaacgcgactggtacgagcagacctac
atcccgaccgtcgccaagcgcggcgcggcgatcatcgaggcgcgcggcctgagcagcgcg
gcctcggcggcgagcgcggccatcgaccacatgcgcgactgggcgctgggcacccgcgaa
ggcgagtgggtcagcatgggcattccctcggacggcagctacggcatccccgagggcctg
atctacggcttcccggtgcgcaccagcggcggcaagtacgagatcgtgcagggcctggac
atctccgacttcagccggggcaagatggacgccaccgcgcaggaactgagcgaggagcgc
gacgaggtccgcaagctcggtctggtgaagtaa

DBGET integrated database retrieval system