KEGG   Drosophila grimshawi: Dgri_GH13196Help
Entry
Dgri_GH13196      CDS       T01061                                 

Definition
(RefSeq) GH13196 gene product from transcript GH13196-RA
Organism
dgr  Drosophila grimshawi
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 276 aa AA seqDB search
MLSLKLVLVLLLQSSAIVLGGVCLIPEPVKRQRSLLDELWKTQPRLDGRIVGGQRINITN
APHQISLQTSAHICGGSLISEQWILTAAHCTEGKTANQLKVRLGSSEAARHGELLRVQKI
VQHEKFNYTNVDFDFSLLQLQHPIKFDESKKAIKLPEAEQMFMDGDPCFVTGWGNTQNLL
EPREWLRQVQVPLVNQQVCNDKYKQYGGITERMICAGYMEGGKDACQGDSGGPMVNEAGV
LVGVVSWGYGCAKPDYPGVYARVGYARDWIKEHSGI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcattgaaactggtgttagttctactgctgcagagcagcgccattgtcctgggc
ggcgtctgtttgataccagagcctgtgaagcgccaacgttcgctgctcgacgagctgtgg
aagacgcagccgcgtctcgatggccgcattgtgggtggccaacgtataaacataacgaat
gcaccacatcaaatctcgttgcaaacatcagctcacatttgcggcggatcactgatctct
gagcaatggattttaacagcggcccattgcaccgaaggtaaaacagcgaaccagttaaag
gtgcgtctgggcagctcggaagccgcgcggcatggagaacttctgcgcgtgcagaagatt
gtgcagcacgagaagttcaactatacgaatgtggatttcgatttctcgctgctgcagctg
cagcatcccatcaaattcgatgagtcgaagaaggccatcaagctgccagaggcggagcaa
atgtttatggacggtgatccgtgctttgtcaccggttggggcaacactcagaatctgcta
gagccacgtgaatggctgcgtcaggtgcaggtgccgctggtcaatcagcaggtctgcaac
gacaaatacaaacaatatggcggcattacggagcgcatgatttgtgctggttacatggag
ggcggcaaggatgcctgccagggtgactctggcggtcccatggtgaatgaggcgggcgtg
ctggtgggcgtggtctcatggggttatggctgcgccaagccagactatccgggcgtctat
gccagagttggctatgcacgtgattggatcaaggagcacagcggcatttag

DBGET integrated database retrieval system