KEGG   Drosophila grimshawi: Dgri_GH15265Help
Entry
Dgri_GH15265      CDS       T01061                                 

Definition
(RefSeq) GH15265 gene product from transcript GH15265-RA
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00480  Glutathione metabolism
dgr00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dgri_GH15265
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dgri_GH15265
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     Dgri_GH15265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 6558466
NCBI-ProteinID: XP_001983982
FlyBase: FBgn0122740
UniProt: B4IX24
LinkDB All DBs
AA seq 243 aa AA seqDB search
MSSGRHLAKGSPTPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTEKPDW
LLDKNPQGKVPALELVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQEKLLIER
FGGVLGAFFKASDGGELEPFWSGLDTYEQELSRRATQFFGGEQTGILDYMIWPWCERLEL
LKLQRGEDYNYDAERFPQLTQWLERMKRDPAVMAFYMEAEVQAEFLRTRSAGKPNYNLLV
KDA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggcaggcacttggctaaaggctctccgacgccggatgtgcccgaggatggg
atactgcggctgtactccatgcgcttttgccccttcgctcagcgagtgcatcttgtcctg
gatgccaaacaaataccctatcacagcatttacataaatctcacagagaaaccagactgg
ctgctcgacaagaatccgcagggcaaggtgccggcattggaactggtacgagagccaggt
ccaccggtgctaaccgaatcgctgctcatctgtgagtacctggacgagcagtatccactg
cgtccgctctacccacgtgatccgctcaagaaggtgcaggagaagctgcttatcgaaagg
tttggtggtgtgctcggcgcgtttttcaaggcatccgatggcggtgagttggagcccttc
tggtcggggctagacacctacgagcaggagctgagtaggcgtgccacacagttttttggc
ggcgaacagacaggcatactggattacatgatctggccatggtgtgagcgactggagctg
ctcaagcttcaacggggcgaggattacaattacgatgcggaacgttttccacaactgacg
cagtggctggagcgcatgaaacgtgatccggccgtgatggcattctacatggaggctgaa
gttcaagcggaatttctgcgcacacgcagcgctggcaagcccaactacaatctgctggtg
aaggatgcctga

DBGET integrated database retrieval system