KEGG   Drosophila grimshawi: Dgri_GH18750Help
Entry
Dgri_GH18750      CDS       T01061                                 

Definition
(RefSeq) GH18750 gene product from transcript GH18750-RA
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dgr  Drosophila grimshawi
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dgri_GH18750
Enzymes [BR:dgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dgri_GH18750
Chromosome [BR:dgr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dgri_GH18750
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dgri_GH18750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 1035 aa AA seqDB search
MATAEAQVNANTNLQKQDLSNLEISNLTPLSAEVISRQATINIGTIGHVAHGKSTVVKAI
SGVQTVRFKNELERNITIKLERLSESKIQKLVHSKQKRIAYEMKQRRLLKGLAQRRQKQQ
KQCQGSSRMDLLPQPSSSHSHLFAHHTRPRRSCSQSSLSPSQSSGYGSVLGSDEHDAILG
SQRIPAAGGMQNNTLKRRRSTRSIPDIQLPVLKISKNNEGVPIKKPKGEHVVEHIQCVEV
VNYEPVFFVKWLGFDSSLNTWEDFVNLSDCVQLEHFVDRQTHFYKVYIDEIVGKLETQLA
NSPPLDLSSINLKQDVDNYEPLPLHLDLILLAQYVAAGSRSQREPERIGKRALRRLQLQH
CHHARRKQLLQLAEFESRMNSIEMPAPPIRVRNDVDLDTIDASFVYIQKNILGALVPRPG
PPIVGCTCSVECNCRSSCCSRLAGELFAYDRTTRRLRLPQGSAIYECNARCKCDASCTNR
LVQHGRKHPLELFKTSNGRGWGVRTPQLLRKGEFVCEYVGEIITTDEANERGKVYDDRGR
TYLFDLDYNATAESEYTIDAANYGNVSHFINHSCNPNLAVFPCWIEHLNVALPHLVFFTL
RQIKPGEELSFDYIRADSDNVPYENLSTAARVEFFLFFCQRYANAKIYKCDNPKCPRPAS
FVSDGSSKDDSMPCARLACSGRFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAG
NESCPQPQTSEHLAAIEIMKLKQILILQNKIDLVKESQAKEQYEEITKFVQGTVAEGAPI
IPISAQLKYNIDVLCEYIVNKIPVPQRDFNTPPRLIVIRSFDVNKPGCEVQDLKGGVAGG
SILSGVLKVGQEIEVRPGVVTKDSDGNITCRPIFSRIVSLFAEQNELQYAVPGGLIGVGT
KIDPTLCRADRLVGQVLGAVGNLPDIYIELEISYYLLRRLLGVRTDGDKKAARVEKLQRN
EILLVNIGSLSTGGRISATKGDLAKILLTTPVCTEKGEKIALSRRVENHWRLIGWGQIFG
GKTITPVLDSQPAKK
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctgaagctcaagtcaatgcgaacacaaatttgcaaaagcaggaccttagc
aatttggaaatcagcaatctgacgcctctgtcagcggaggtgatctcgcgccaggcaaca
atcaacattggcacaatcggtcatgtagcccacggcaaatccaccgtcgtcaaagccatt
tctggagtgcagactgtccgctttaaaaatgaactggaacgaaatattacaattaaactc
gaacgcttaagcgaatcgaaaatccaaaagcttgtgcactccaagcagaagcgcattgcc
tacgaaatgaagcagcgtcgactgctcaaaggccttgcccagcgcaggcaaaaacagcaa
aagcaatgccaaggaagcagccgcatggacttgttgccacagccgtcttcttcccacagc
catttattcgcacatcacacaagacctaggcgcagttgcagccagagctcgctcagtccc
agccagagtagcggttatggcagtgttttgggctcggacgaacacgatgctattctggga
tcacaacgcattccagctgccggtggtatgcaaaataatactctgaagcgacgacgcagt
acccgatctatccccgatatacaattgcccgttctgaagatctccaaaaacaatgagggt
gtgccgatcaagaagccaaaaggcgagcacgtcgtggagcacattcaatgcgtcgaagtt
gtgaattacgagcccgttttctttgtcaagtggttgggctttgacagcagcctgaacacc
tgggaagattttgttaatctctccgattgcgttcaactcgagcattttgttgaccgccaa
acccacttttataaagtgtatattgacgaaattgtgggcaagctggagacacaattggcc
aatagtcctccacttgatttaagcagcattaacctcaagcaggatgtggataactatgag
cccttgcccttgcatttagatttaatactgctggcccagtacgttgcggctggcagtcgc
agtcaacgcgaaccggaacgcattggcaagcgggcactgcgacgccttcaactccaacat
tgccaccatgcgcgtcgtaagcagctgctgcagctggctgaattcgagagccgcatgaac
agcatcgagatgccagcaccgcccattcgtgtgcgcaacgatgttgatctggacaccatc
gatgcaagtttcgtctacatacaaaagaacatattgggcgctctggtgccacggcctggg
ccgcccattgtcggctgcacttgttcagtagagtgcaactgcaggagtagctgctgttcc
cgtctcgccggcgagctgtttgcttacgatcggacaacgcgacgcttgcgtctacctcag
ggcagtgccatatatgagtgcaatgctcgctgtaaatgtgatgccagctgcacaaatcga
ttagtgcaacacggacgcaagcatccgctggaattgttcaagacgagcaacggaaggggc
tggggtgtacgcacaccccagctgctgcgcaagggcgagtttgtgtgcgaatatgttggc
gagatcatcaccaccgatgaggcgaatgagcgcggcaaggtctacgacgataggggacgc
acgtatctctttgatctggattacaatgcgactgcggagagtgaatataccattgatgcg
gctaattatggcaacgtttcgcactttatcaatcattcgtgcaatcccaatttggctgtg
tttccctgctggattgagcatctgaacgttgcactgccgcatttagtattctttacgctg
cgccaaattaaacctggcgaggagctcagctttgattacatacgcgctgatagcgacaat
gtaccctatgagaatctatcgacagcagcccgcgttgaatttttcctttttttttgccaa
agatatgccaatgcaaaaatctataagtgcgataatcccaagtgcccacgcccggccagc
tttgtatcggatggctcaagcaaggatgacagcatgccatgtgcacgtctcgcctgctcc
ggtcgcttcagattagtgcgtcacgtgagcttcgtcgattgccccggtcacgacattctt
atggcaaccatgttaaacggcgccgctgtgatggatgctgcactgctgcttattgccggt
aacgagtcgtgtccacaaccacaaacctcagagcatttggctgccattgagattatgaaa
ctgaaacagattttgatattgcaaaataagatcgatttggttaaggagagtcaggccaag
gagcagtacgaggagatcacaaagtttgtgcagggcaccgtcgccgagggtgctccgata
attccaatttcggcacagctgaagtacaacatcgacgtactctgcgagtacattgttaac
aagattcctgtgccgcagcgtgatttcaatacgccgccccgtttaattgtcatacgatcc
ttcgatgtgaacaaacctggctgtgaggtgcaggatctcaagggtggcgttgccggcggc
tccatattgagcggtgtgctcaaagttggtcaggagattgaggtgcgtcctggtgttgtc
accaaggacagcgatggcaacatcacttgccgtcccattttctcgcgcatcgtctcactg
tttgccgaacagaatgagctacagtatgcagttcccggcggcttgattggtgtgggcacc
aaaattgatcccacactctgccgtgccgatcgtttggttggtcaggtgctcggcgccgtt
ggcaatttacccgacatttacattgagctggaaatttcatattacctgctgcgtcgattg
ctcggtgtgcgcaccgatggtgacaagaaggccgcacgtgtggagaagctgcaacgtaac
gaaatcttgctggtcaatattggatcactcagcactggcgggcgcatctcggccaccaaa
ggtgatctggccaagattctgctcacaacgcccgtttgcacggaaaagggtgaaaagatt
gcacttagcagacgtgtggagaatcattggcgtttgattggctggggacagatctttggt
ggcaagacaattacgcccgttttggatagtcagccagctaagaagtaa

DBGET integrated database retrieval system