KEGG   Drosophila grimshawi: Dgri_GH20186Help
Entry
Dgri_GH20186      CDS       T01061                                 

Definition
(RefSeq) GH20186 gene product from transcript GH20186-RA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00480  Glutathione metabolism
dgr00980  Metabolism of xenobiotics by cytochrome P450
dgr00982  Drug metabolism - cytochrome P450
dgr00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dgri_GH20186
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dgri_GH20186
   00982 Drug metabolism - cytochrome P450
    Dgri_GH20186
   00983 Drug metabolism - other enzymes
    Dgri_GH20186
Enzymes [BR:dgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dgri_GH20186
Transporters [BR:dgr02000]
 Other Transporters
  Pores ion channels [TC:1]
   Dgri_GH20186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_C_3 GST_N_2 DnaJ
Motif
Other DBs
NCBI-GeneID: 6567815
NCBI-ProteinID: XP_001993600
FlyBase: FBgn0127650
UniProt: B4JRE6
LinkDB All DBs
AA seq 209 aa AA seqDB search
MADFYYLPGSSPCRSVIMTAKAVGVDLNKKLLNLQAGEHLKPEFVKINPQHTIPTLVDNG
FALWESRAILVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAK
APADPEAFKKIEAAFEFLNTFLEGQNYVAGDSLTIADIALVATVSTFEVAGFDISKYENV
NKWYQNAKKVTPGWDENWAGCLEFKKYFE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctgacttctactatttgcccggctcctcgccctgccgctccgtcatcatgaccgcc
aaggccgtcggtgttgatttgaacaagaagttgctcaatctgcaggctggcgagcatctg
aagcctgaattcgtgaagattaatcctcagcacaccattcccaccttggtggacaatgga
ttcgctctgtgggagtcgcgtgccatcctcgtctatctcgtggagaagtacggcaagacc
gactctctgtaccccaagtgccccaagaagcgtgccgtcatcaaccagcgactgtacttc
gacatgggcactctgtatcagagcttcgccaactactactatccacaggtgttcgccaag
gcgcccgccgatccggaggccttcaaaaaaatcgaggctgccttcgagttcctcaacacc
ttcttggagggtcagaactatgttgctggtgattcactgacaattgccgatattgccttg
gtcgccactgtgtccacattcgaggtggctggcttcgacatcagcaagtacgaaaatgtg
aacaagtggtaccagaatgccaagaaggtgactcccggctgggatgagaactgggctgga
tgcttggagttcaagaaatactttgaataa

DBGET integrated database retrieval system