KEGG   Debaryomyces hansenii: DEHA2D08954gHelp
Entry
DEHA2D08954g      CDS       T01026                                 

Definition
(RefSeq) DEHA2D08954p
  KO
K02358  
elongation factor Tu
Organism
dha  Debaryomyces hansenii
Brite
Translation factors [BR:dha03012]
 Eukaryotic Type
  Elongation factors
   DEHA2D08954g
 Prokaryotic Type
   DEHA2D08954g
Mitochondrial biogenesis [BR:dha03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DEHA2D08954g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DEHA2D08954g
  Exosomal proteins of breast cancer cells
   DEHA2D08954g
  Exosomal proteins of colorectal cancer cells
   DEHA2D08954g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
D:complement(726698..727972)
Genome map
AA seq 424 aa AA seqDB search
MFRNVVNAFRSTGRTSFKVRPTSIRTYAAFDRSKPHVNIGTIGHVDHGKTTLTAAITKVL
ADKGGASFLDYQSIDRAPEERSRGITISTTHVEYETEKRHYAHVDCPGHADYIKNMITGA
AQMDGAIIVVAASDGQMPQTREHLLLARQVGVQHLVVFVNKVDTIDDPEMLELVEMEMRE
LLSQYGFDGDNTPVVMGSALCALENKQPEIGVQAIEKLLDNVDEYIPTPQRDLEQPFLLP
VEDVFSISGRGTVVTGRVERGTLKKGEEIEIVGNFDKTFKATVTGIEMFKKELDAAMAGD
NAGILLRGVKRDEINRGMVLAKPGTVTSHKKVLASLYILSKEEGGRHSSFGENYKPQLFL
RTTDVTGTLRFPEGADHSQMVMPGDNIEMEIELVRKTPIEVNQRFNIREGGKTVGTGLVT
RILE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaacgttgttaatgctttccgttcaactggacgtacttcattcaaagttcgt
ccaacttcgattagaacttacgcggcattcgaccgttcgaagccacatgttaacattggt
accatcggacatgtcgatcacggtaagactaccttaacagctgctatcaccaaggttttg
gccgataagggtggtgcttctttcttagattatcagtctattgatagagctccagaagaa
agatccagaggtattaccatttccaccactcatgttgaatacgaaactgagaagagacat
tatgcccatgttgattgtccaggtcacgctgattacattaagaatatgattactggtgct
gctcaaatggatggtgctatcatcgttgttgcagcttctgacggacaaatgccacaaact
agagaacatttgttattggccagacaagttggtgttcaacacttagttgttttcgtcaac
aaggttgatactattgacgacccagaaatgttggaattagttgaaatggaaatgagagaa
ttattgtcgcaatacggttttgatggtgacaacactccagttgttatgggatctgcttta
tgtgctttagaaaataagcaaccggaaattggtgtccaagccattgaaaagttgttagac
aacgttgatgaatacattccaactccacaacgtgatttggaacaaccattcttgttacct
gttgaagatgttttctctatctccggtagaggtactgtcgttaccggtagagttgaaaga
ggtactttaaagaagggtgaagaaatcgaaattgtcggtaacttcgacaagaccttcaag
gccactgttactggtattgaaatgttcaagaaggaattggatgctgctatggctggtgac
aatgccggtattttattgagaggtgttaagagagacgaaatcaaccgtggtatggtttta
gctaagccaggtactgtcacttcccacaagaaggtcttagcctccttgtatattttaagt
aaggaagaaggtggtcgtcactcctcattcggtgaaaactacaagccacaattgttcctt
agaaccaccgatgtcactggtactttaagattcccagaaggtgctgaccactctcaaatg
gtcatgccaggtgacaacattgaaatggaaatcgaattagtcagaaagaccccaattgaa
gtcaaccaacgtttcaacatcagagaaggtggtaagaccgttggtactggtttagtcacc
agaattcttgagtaa

DBGET integrated database retrieval system