KEGG   Debaryomyces hansenii: DEHA2F02420gHelp
Entry
DEHA2F02420g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F02420p
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dha  Debaryomyces hansenii
Pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dha00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    DEHA2F02420g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     DEHA2F02420g
Chromosome [BR:dha03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     DEHA2F02420g
   HDAC complexes
    Sin3A-HDAC complex
     DEHA2F02420g
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    DEHA2F02420g
  Chromatin remodeling factors
   NuRD complex
    DEHA2F02420g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
F:201635..203128
Genome map
AA seq 497 aa AA seqDB search
MYVQLPFDDLKVDPTQKKRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKM
EIYRAKPATKQEMCQFHTDEYIDFLSRVSPDNLDMFAKEQIKFNVGDDCPVFDGLFEYCG
ISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVL
YIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGKGKYHAINVPLRDG
IDDATYKSIFEPVISKVMEWYQPSAIVLQCGGDSLSGDRLGCFNLSMSGHANCINFVKSF
NVPMMVVGGGGYTMRNVARTWSFEAGLLNNVVLPSELPYNEYYEYYGPDYKLDVRPSNMY
NANSPEFLNKILTNILTNLENTKHAPSVQMNYVPNDAEDLGDIDEDTQEAIDTKGGSQQA
RDEITQPDNEFYEDDDKDAGSRDIQNFSKSASASESKPAELETTAQPETLEEPEDEKMLT
DEELKEINELNSNENNA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttcaattaccatttgatgatttgaaggtcgatcctactcaaaagaagagagta
gcgtatttttatgatgctgatgtgggtaactatgcttatggtgctggtcatccaatgaaa
cctcatcgtataagaatggcacattcgttaattatgaattacgggttatacaagaagatg
gagatttatcgtgccaaaccggctactaaacaagaaatgtgccaatttcatactgatgaa
tatattgactttttaagccgtgtttcccctgataatttagacatgtttgccaaagagcag
attaaattcaatgttggagatgattgtccagtttttgacggattatttgagtattgtggt
atttcaggtggtgggtcgatggagggtgctgcaaggttaaatagaggaaaatgtgatatt
gctattaattatgcaggtggtttacatcatgctaaaaaatcggaagcttctgggttttgt
tacttaaatgatatcgtattaggtattattgaattattgagatatcacccaagagtttta
tatattgatattgatgttcatcatggtgatggagtggaagaagccttctatacgaccgat
agagtgatgacctgctccttccacaagtatggtgaatttttccctggtactggtgaattg
agagatattggtgttggtaagggtaaataccatgcaataaacgtgcctttaagagatggt
attgatgatgctacttacaagtccattttcgaaccggtaatcagcaaggtcatggagtgg
tatcaaccttcggctattgtcttacaatgtggtggtgattcattgagtggtgacagattg
gggtgcttcaacttgtcaatgtcaggccacgctaactgtattaattttgtcaagtcattc
aacgttccaatgatggtcgttggtggtggtggttatacaatgagaaacgttgctaggact
tggtcttttgaagcgggtttattgaacaacgtcgtattacccagcgaattgccatacaat
gaatactacgagtattatggtccagactacaaattggatgtcagaccatccaatatgtac
aatgccaattctcccgaatttttaaataaaatattaactaatattttgactaacttggaa
aatactaagcatgcgccatcagttcaaatgaattacgttccgaatgatgctgaagacttg
ggtgacatcgatgaagacacacaagaggcgatagacaccaagggcggttcgcagcaagca
agagatgaaataactcaaccagacaacgaattctacgaagatgacgataaagatgctggt
agtagagacatccaaaatttcagcaaatctgcgtctgcttctgaatctaaacctgccgag
ttagaaactacagctcaaccagaaacattggaagagcctgaagatgagaaaatgcttact
gacgaagaattgaaagagataaacgaattaaactcaaacgagaataatgcttaa

DBGET integrated database retrieval system