KEGG   Delftia sp. HK171: BO996_05240Help
Entry
BO996_05240       CDS       T04584                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dhk  Delftia sp. HK171
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dhk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BO996_05240
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BO996_05240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1162981..1164570
Genome map
AA seq 529 aa AA seqDB search
MSLAASPLPTGRAALLERLAQPETYDLAIIGGGATGLGVALDAAARGFKVVLVESHDFAK
GTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLAFVMPSYKLLDTPF
YGIGLKMYDALAGKAGLGATEFLSRSSTVKCLPTVRQQGLKGGVKYWDGQFDDARLALAL
ARTAAAKGALLVNYCPALELLHEGGKVAGLVCEDTESGRRFTLRAKCVVNATGPWVDLFR
QQDAEAQGRPVKPMVAPSQGVHVVVDRDFLPSDHALLVPKTADGRVLFAVPWLGKVILGT
TDTPRNDLAREPLPFPEELDFILTEAGRYLTRQPTLADVRSMWVGLRPLVKPQDDDGENT
KKISREHTVMSSRTGLVTVTGGKWTTYRAMAEDVLSECFAIGRLPHRPGGVTARLPLAGA
PAESAVHHRMNQVQGLHSYGTEASAVEALPGNDEWLADGLNEAMVRFAARFEYARTVEDV
LARRSRLLFLDARKAAEVAPRVAAILQEELGQDAGLADFMPLAAQYLPA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgctgcttcccctctgcccaccggccgcgccgccctgctggaacgcctggcc
cagcctgaaacctacgatctggccatcatcggcggcggtgccaccggcctgggcgtggcc
ctggacgcggcggcgcgcgggttcaaggtcgtgctggtggagtcgcatgactttgccaag
ggcacgtcctcgcgtgcaaccaagctggtccatggtggcgtgcgttacctggcccagggc
aacatcgccctggtgcgcgaagcgctgcatgagcgcaccacgctgctgcacaacgcaccc
cacctggcgcagccgctggcctttgtcatgccgtcctacaagctgctggacacgccgttc
tacggcatcggcctcaagatgtatgacgcgctggccggcaaggcaggcctgggcgccacc
gaattcctctcgcgctccagcaccgtcaagtgtttgcccaccgtgcgccagcaaggcctc
aagggcggcgtcaaatactgggacggccagttcgacgatgcccgcctggcgctggcgctg
gcacgcacggccgccgccaagggcgcgctgctggtcaactactgccccgcgcttgaactg
ctgcatgaaggcggcaaggtcgccggcctggtctgcgaagacacggaatcgggccggcgc
ttcacgctgcgcgccaagtgcgtggtcaacgccaccggcccctgggtggacctgttccgc
cagcaggacgccgaggcccagggccgtcccgtcaagcccatggtcgcgcccagccagggc
gtgcacgtggtggtggaccgcgacttcctgcccagcgaccacgccctgctcgtgcccaag
acggccgatggccgcgtgctctttgccgtgccctggctgggcaaggtcatcctgggcacc
accgacaccccgcgcaacgacctggcacgcgagcccctgccgttccccgaggagctggac
ttcatcctcaccgaggccggacgctacctcacgcgccagcccacgctggccgacgtgcgc
agcatgtgggtcggcctgcgcccgctggtcaagccccaggacgatgacggcgagaacacc
aagaagatcagccgcgagcacacggtcatgtccagccgcaccggcctggtcaccgtcacg
ggcggcaaatggaccacctaccgtgccatggccgaagacgtgctctccgaatgctttgcc
atcggccgcctgccgcaccgccccggcggcgtcacggcccgcctgccgctggccggcgcc
ccggccgagtccgccgtgcaccaccgcatgaaccaggtccagggcctgcactcctatggc
acggaagcctcggcggtggaggcgttgccgggcaacgacgaatggctggcagacggcctg
aacgaagccatggtgcgctttgccgcgcgcttcgagtacgcgcgcaccgtggaagacgtg
ctggcgcgccgcagccgcctgctgttcctcgatgcgcgcaaggccgccgaggtggcgccg
cgcgtggcagccatcctccaggaggagctggggcaggacgccggcctggcggacttcatg
ccgctggcggcccagtacctgccggcctga

DBGET integrated database retrieval system