KEGG   Delftia sp. HK171: BO996_15245Help
Entry
BO996_15245       CDS       T04584                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
dhk  Delftia sp. HK171
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dhk00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BO996_15245
Enzymes [BR:dhk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BO996_15245
Transporters [BR:dhk02000]
 Other Transporters
  Pores ion channels [TC:1]
   BO996_15245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3412433..3413044)
Genome map
AA seq 203 aa AA seqDB search
MKLYHFPLSGHAHRARLFLGLLGVEHELVHVDLANGAQKKPEFLALNPLGQVPVLDDNGT
VIADSNAILVYLARKLDRQDWMPLGAQAEAEIQKWLSIAAGPIAFGPAAARLVTVFKAPF
QAEEVIARAHAILGKIEAQLTTRPFLTGATPTIADVALYSYIASAPEGNVDLQPYREVRA
WLGRIEALPGFVAFAQTPAGLRA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctaccactttcccctgtccggccacgcccaccgcgcccgcctcttcctcggc
ctgctgggcgtggagcatgagctggtccacgtggacctggccaacggcgcgcagaagaag
cccgaattcctggcgctgaacccgctgggccaggtgccggtgctggacgacaacggcacg
gtgattgccgactccaacgccatcctggtctacctggcgcgcaagctggaccgccaggac
tggatgcccctgggcgcacaggccgaggctgagatccagaaatggctgagcatcgccgcc
ggccccattgccttcggcccggcggcggcccggctggtcacggtgttcaaggcccccttc
caggccgaggaagtgatagcccgcgcccacgccatcctcggcaagatcgaggcgcaattg
accacccgccccttcctcaccggcgccacgcccacgattgccgacgtggccctgtacagc
tacatcgccagcgcgcccgagggcaatgtggacctgcaaccctaccgcgaagtgcgcgcc
tggctcggccgcatcgaggcgctgccgggcttcgtggcattcgcccagacaccggccggc
ctgcgggcctga

DBGET integrated database retrieval system