KEGG   Acidovorax ebreus: Dtpsy_0271Help
Entry
Dtpsy_0271        CDS       T00853                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
dia  Acidovorax ebreus
Brite
Translation factors [BR:dia03012]
 Eukaryotic Type
  Elongation factors
   Dtpsy_0271
 Prokaryotic Type
   Dtpsy_0271
Mitochondrial biogenesis [BR:dia03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dtpsy_0271
Exosome [BR:dia04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dtpsy_0271
  Exosomal proteins of breast cancer cells
   Dtpsy_0271
  Exosomal proteins of colorectal cancer cells
   Dtpsy_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
289235..290425
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKGYDQIDNAPEEKARG
ITINTSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYDFPGDDTPIIRGSAKLALE
GDQSDKGEPAIMRLAEALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIRDTQKTTVTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPADKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaagtttgaacgtaccaagccccacgtgaacgtgggcacgatcggtcac
gtggaccatggcaagacgacgctgacggcggccatcgccacggtgctgtccaagaagttc
ggcggcgaagccaagggctacgaccagatcgacaacgcccctgaagaaaaggcgcgcggc
atcacgatcaacacctcgcacgtggaatacgaaacggccacccgccactacgcccacgtc
gactgccccggccacgccgactacgtcaagaacatgatcaccggcgccgctcagatggac
ggcgccatcctggtgtgctcggccgctgacggcccgatgccccagacgcgcgagcacatc
ctgctggcccgtcaggtgggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtcgacgacgaggaactgctcgagctggtcgagatggaagtgcgtgaactgctggacaag
tacgacttccccggcgacgacacccccatcatccgcggctccgccaagctggccctggaa
ggtgaccagtccgacaagggcgaacccgccatcatgcgcctggccgaagccctggacacc
tacatccccacgcctgagcgcgccgtggacggcgccttcctgatgcctgtggaagacgtg
ttctccatctccggccgcggcaccgtggtgaccggccgcgtcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggtatccgcgacacgcaaaagaccaccgtcaccggc
gtggaaatgttccgcaagctgctggaccagggccaggctggcgacaacgtgggcctgctg
ctgcgcggcaccaagcgcgaagacgtcgagcgcggccaagtgctgtgcaagcccggctcc
atcaagccccacacccacttcacggctgaggtgtacgtgctgagcaaggacgaaggcggt
cgtcacacgcccttcttcaacaactaccgtccccagttctacttccgcaccaccgacgtg
accggctccatcgagctgccggccgacaaggaaatggtgatgcccggcgacaacgtgtcg
atcactgtgaagctgatcaaccccatcgccatggaagaaggcctgcgcttcgctatccgc
gaaggcggccgtaccgtgggcgccggcgtcgttgccaagatcattgcgtaa

DBGET integrated database retrieval system