KEGG   Dyella jiangningensis: CH75_08880Help
Entry
CH75_08880        CDS       T03074                                 

Definition
(GenBank) acyl-phosphate glycerol 3-phosphate acyltransferase
Organism
dji  Dyella jiangningensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1890671..1893481)
Genome map
AA seq 936 aa AA seqDB search
MAIQTPSPGVMQTFVDEEIASLLHELHPAATQWPDIRPDRKLDKDLGLDSLSRMELLARL
EDRFQVAIPTQAGTEASTPGELLKVLLRSEPRLVRRDVAAPATTYPIAPLDVPAEAATLP
DVLAWHAQKHGVRAHVHFVEGEADGCVLTYAALWEKAGRIAGGLQERGVRPGETVALMFP
THPDLLASFFGVMRAGAVPVPLYPPSRPSEFSEYWRRQAGILQNCQARIMLIGPSLSAHR
QLVGVMAGTVEHVLTADELQGNAPPVQPVPAASDDLAMLQYTSGSTADPKGVMLTHANLL
SNLRAMGQAIRVSAGDVFVSWLPLYHDMGLIGAWLGCLYFGIPLVLMSPQAFLIRPERWL
WAIHRYQGTLSAAPNFAYELCLHRIEDADVNKLDLSRLRLAFCGAEPVSPVTMQQFTERF
AKYGLRTQALFPVYGLAENALALTFPPLDRGLKMLAIERERFLRNGEAVPCRHATTPSLT
FVSCGAPLPGNELRVVDEASSELPDGRQGHIEFRGPSATTGYYRKEELSHAFMHDGWRDT
GDLGFVHQGELYLTGRSKDVIIRAGRHLHPQHIEQEVGDVPGVRKGRVAAFGAHAEGTER
LVVVAETRVLDVAGRKALRAAIDAAVQKMAGEPADEIVLAAPGAVLKTSSGKLRRAACKE
AYEAGQLGSPDRVHLAAVVWRSLWSRMRRHGVRCRELTYAAYAWTVLAAMSLLAAPAILV
LPTLDQRWWLVRKLLGATALLTHVRLERQWVAALPSEPCIFIANHASNLDALVAIWALPR
PVSIVAKRELATWPLHAFLKRLGVVFVDRNDFQRATSIVKTVQEQRRDLLFFPEGTFRRM
PGLLPFKLGAFLTATQAGMPIVPLVLKGTRAVLRGDDRLPRAGVIGVTIETPVRPRSHAP
AWQEALRLSDAARALYLHASGEPDLGEAEFGALSER
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggccatccagacgccttcgcctggcgtgatgcagacattcgtggatgaagagatcgcc
tctcttctgcacgaacttcacccagccgccacacagtggccggacatccgcccggatcga
aagctggacaaggacctggggctggacagcctgtcccgaatggagctgctggcgcggctg
gaagatcggtttcaggtggccatacccacacaggccggcaccgaggcgagcacgcccggc
gaattgctcaaggtcttgttacggtctgagccacgccttgtccgacgtgatgtcgccgcc
ccggcaactacctatccgatcgcgccactggacgttcccgccgaggccgccacgttgccg
gatgtgcttgcctggcacgcgcagaagcacggcgtacgcgcacacgtccatttcgtggag
ggcgaagcggatggctgcgtgctcacctatgcggcgctttgggaaaaagctggacgtatt
gccggcgggcttcaggagcgcggcgttcgccccggcgaaaccgtggcgctgatgtttccg
acgcatcccgacctgttggcctcgttttttggcgtgatgcgtgccggggctgtgcccgtg
ccgttatatccgccatcgcggcccagcgagttctccgaatactggcgtcggcaggcgggt
atcctgcagaactgccaggcgcgcatcatgctcatcggcccatcgctgtcggcacaccgg
cagctggttggcgtcatggccggcacggtcgagcacgtgcttactgccgacgaactccag
gggaacgctccgcctgtgcaaccggtaccggccgcttccgatgatctggcgatgttgcaa
tacacctcgggaagcaccgccgatccgaaaggcgtgatgctgacccacgccaacctgctg
tcgaatctccgcgcgatgggccaggcgatacgcgtgtcggcgggcgacgtgtttgtcagc
tggttgccgctttatcacgacatggggctcatcggcgcctggctgggctgcctttacttc
ggcattcccctcgtgctgatgtcgccacaggccttcctgatacggccggaacggtggctg
tgggccatccaccgctaccaaggcacgttgtctgccgcccccaatttcgcctacgagctg
tgcctgcatcgcatcgaagacgccgacgtgaacaaattggatctctcgcggcttcgtctc
gctttctgcggcgccgagcccgtttcgccagtcaccatgcagcagttcaccgagcgcttt
gcgaaatacggcctgcgcacacaggccctctttcccgtatatggcctggccgagaatgcg
cttgcgttgacgttcccaccgctggaccgtggcctgaagatgttggcgatagaacgcgaa
cgatttctacgcaatggtgaagccgtaccgtgccgccatgcgaccacaccgtcgttgacg
ttcgtgtcgtgcggggccccgctgcctggaaatgagctgcgcgtcgtcgatgaggcatca
agtgaactgccggatggccgccagggacacatcgaattccgcggcccttcggccaccacc
ggctactaccgcaaggaggagctgagccatgcgttcatgcatgacggctggcgagacaca
ggcgatctcggcttcgtgcaccagggcgaactgtacctcacgggaaggtcgaaggacgtc
atcatccgcgcgggccgacatcttcacccgcaacacatcgagcaggaagtgggcgacgtc
cctggtgtgcgaaaggggcgcgtcgccgcgttcggcgcgcatgccgaaggcacggagcga
ctggtggtcgtggccgaaacgcgggtcctggatgtggcaggccgaaaggccttgcgggcc
gcgatcgatgccgccgtgcaaaagatggccggagaaccggcggatgagatcgtgctcgcc
gcaccgggagccgtgctgaaaacgtcgagcggcaagcttcgacgcgccgcctgcaaggag
gcttacgaagccgggcaattgggctcgcccgatcgggtgcatctcgcagcagtggtctgg
cgctcgctgtggagtcgcatgcgacgccacggggtgcggtgccgtgaactcacttatgcc
gcttatgcctggacagttctcgccgcgatgagcttgcttgccgcgcctgccatcctggtc
ttgccgacgctcgatcaacgctggtggctggtgcgcaaactgctgggcgccacggcgttg
cttacccatgttcgccttgaacgccagtgggttgccgcacttccgtcggagccgtgcata
ttcatcgccaatcacgccagcaacctcgatgccctggtggcgatctgggctcttccgcgt
cccgtcagcatcgtcgccaagcgagagctcgccacatggccgttgcatgccttcctgaaa
cgcctgggcgtggtcttcgtggatcgcaacgatttccagagggcaacgtcgatcgtgaaa
accgtccaggagcagcgacgcgacctgctgttcttccccgaaggcacgttccggcgcatg
ccggggttgttgccgttcaagctcggcgcgttcctgaccgcgactcaggcaggcatgccg
atcgtgccgctggtgctcaagggcacgcgcgcggtgctgcgaggcgatgatcgcctgccc
cgcgcaggggtcattggcgtgacgatcgaaacacctgtgcgtcctcggtctcacgcccct
gcatggcaggaagcgttacggctttccgacgcggcgcgcgcactgtacctgcatgcaagc
ggtgaaccggatctgggagaggcggagttcggcgcgttgtcggagcggtaa

DBGET integrated database retrieval system