KEGG   Dyella jiangningensis: CH75_21725Help
Entry
CH75_21725        CDS       T03074                                 

Definition
(GenBank) glutathione S-transferase
Organism
dji  Dyella jiangningensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AHX15549
UniProt: A0A023NYX1
LinkDB All DBs
Position
complement(4748683..4749435)
Genome map
AA seq 250 aa AA seqDB search
MSPRLILIGNYVSPYVRKVLACLELKGLDYEIDPITPFIGDDRFTELSPLRRIPVLIDGD
LVLNDSSVICQYLEDRSAQPSLYPADIAERAKARWIEEYCDTHLAGALIGKLFYQKAIRR
HFFQEEADEALVTHACAVEIPATLDYLERWAPADGYLFGPLSIADISIASYFRTASFVRY
AIDADRWPRTAALVARVLSLPSLQKLAKLEDAVLRVPFAQHRDALAAAGAPLTVDTMATL
TPRKGVPRFA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccacgcctgatcctgatcggcaactacgtttcgccgtacgtccgcaaggtgctg
gcgtgcctggagctgaaaggcctcgactacgagatcgatccgatcacgcccttcatcggc
gacgaccgcttcaccgaactcagcccgcttcggcgcattccggtactgatcgatggcgat
ctggtgctcaacgactcctcggtcatctgccaatacctggaagatcgttcggcgcagccc
tcgctttatcccgccgatatcgccgagcgcgccaaggcgcgctggatagaggagtactgc
gatacgcacctggccggcgcactgatcgggaagctgttctaccagaaggcgatccgacgc
cactttttccaggaagaagcggacgaggcgctggtgactcacgcctgcgcggtggagatt
cccgccaccctcgattacctggaacgctgggcaccggcggacggctacctgttcggaccg
ttgtcgatcgccgacatcagcattgcctcgtatttccgtacagcgtccttcgtgcgctac
gcgatcgatgcggatcgctggccgcgcacggcggcgctggtggcgcgcgtgctgtccctg
ccgtcgttgcagaagctggcgaagctggaagatgctgtattgcgcgtgccgttcgcgcaa
catcgtgatgcgctcgccgcagcgggtgcgccactgacggtggataccatggccacgctc
acgcctcgcaagggtgtgccccggtttgcgtga

DBGET integrated database retrieval system