KEGG   Desulfurococcus amylolyticus 1221n: DKAM_0881Help
Entry
DKAM_0881         CDS       T00817                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    DKAM_0881
Enzymes [BR:dka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DKAM_0881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(843521..844999)
Genome map
AA seq 492 aa AA seqDB search
MRIVIIGAGVVGLSIARVLSMYKGLDIVVVEKEPDVGWGASKANTSIIHPGHEEDPELHP
LRARLCVEGNKLWRQWVKELDIPAKWPGELMVFTNSEEEKEALRYIDTARRNNVPGVRAV
YGDELRRLEPAISPMAVGAVYAPTAGNISPFEAVAALAENLVENGGRILVNTLVKSVRIK
DKAVEGVETSGGFIQADIVINAAGVHADEISHSAGVEEDFVIRPRKGEYIVFDEDTSVKP
LRLLHTTPTSLTKGVYAITTTGGDLLIGPTAVDMPYELKEDTSTTLEGIEYLLREAGKLL
RELPPRSLITRTFAGVRPEPPHGEWLIKVYEEPWGFINVAGIRSPGLTAAPAIAYYVADM
ISKSYAVSLEHRSDWKPYRRGFLRLHGKSLREIDELVSVNPDYGEVICYCRTVSKAEILE
AVKRIKTIGAQVTLDGVKFRTKAGFGRCQGSFCRWRIAGIIAGLEGKEMHEVVVKMERYG
LGDVKKMLREEA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaggatagttatcattggagccggtgtagtagggttatccatcgcaagagtcctcagc
atgtataagggactagatatagttgttgttgagaaagagcccgatgtaggctggggggcc
tctaaggctaatacatctataattcacccgggacacgaggaagaccccgagttacaccct
cttagagcgagactctgcgtggaaggtaacaagctctggcgtcaatgggttaaggagctg
gatataccggcaaagtggcctggtgaactaatggtcttcactaacagcgaggaagagaag
gaagcgctgagatacattgacacagccagaagaaacaatgtgccaggggttagggcggta
tatggagatgaattaaggagacttgaaccagctataagcccgatggctgtgggggcagta
tatgcacccacagctggtaatatatcaccttttgaagctgttgccgcgctagccgagaac
cttgttgaaaatggtgggagaatactcgtgaatacactggttaaatcagtcagaattaaa
gacaaagctgttgaaggagttgaaacaagtggagggtttattcaggccgacatagtgatt
aatgctgcgggtgttcatgccgacgagatttcccacagcgctggtgtcgaagaggacttc
gtgataaggcctaggaaaggggaatatatagtatttgatgaggataccagcgttaaaccc
ttaaggcttctgcatacaacacctacaagtttaaccaaaggagtttacgctatcacgaca
accgggggagacttactcataggtcctacggcagtggacatgccatacgagttgaaagag
gatacctcaacaacacttgaaggcatcgagtatttactcagggaagcaggtaaactactg
agagagctacctcctagatcacttatcacgaggacatttgctggtgtaagacctgagccc
ccacatggtgaatggctgattaaagtatacgaggagccatggggcttcatcaatgttgca
gggataagatccccagggctcacagcagcccctgcaatagcatattatgtagcagacatg
atctctaaatcatacgcggtgagcctggagcacaggagtgactggaagccttatagaaga
ggattcctcaggcttcacggtaaatccctacgggaaatagatgaactagtatcggtaaac
cctgattacggcgaggtaatatgctactgtagaaccgtatcaaaggcggagatacttgaa
gcggttaagaggattaagaccataggagcgcaggtaacccttgacggtgtaaagtttagg
actaaagctggattcggcaggtgccagggctccttctgcaggtggaggatagcggggatt
attgctggcttggagggtaaggagatgcatgaagttgtagtcaagatggagagatatggt
ttgggagatgttaaaaagatgctgagagaggaagcctag

DBGET integrated database retrieval system