KEGG   Dokdonella koreensis: I596_1523Help
Entry
I596_1523         CDS       T04377                                 

Definition
(GenBank) Dipeptidyl carboxypeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dko  Dokdonella koreensis
Brite
Enzymes [BR:dko01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     I596_1523
Peptidases [BR:dko01002]
 Metallo Peptidases
  Family M2
   I596_1523
Exosome [BR:dko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I596_1523
CD molecules [BR:dko04090]
 Proteins
  I596_1523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1761617..1763539)
Genome map
AA seq 640 aa AA seqDB search
MNVKLLAAALLAALAGACAATAPRDKTTQAAPGAGSESADAFVGRVNDAFRATSPEMNAA
QWLAVTYINEDSQLLAAKSNERSLTQLNAFVEEARRYDGQALSADTARSIALLKLATAMP
APKDPAKLAELARIASKLEGAYGAGTYCRDHDGKRQCRQLGELEDVLRDPKASYEDQLDA
WTGWHTIAQPMRADYRRFAELVNEGAREMGFADAGAMWRSGYDMDPDAFRAETDRLWEQV
KPLYSDLQCYVRGKLEKKYGARGHVDGLLPAHLTGNMWQQDWGNLWPILEPYKGAGSLDI
TGALEKQRAAELRRLRAGFKGRASAEDSVRLEREADLAIARSMTERAEDFYTSLGMPKLP
ESFWTKAQLVKPRDRDVVCHASAWDMNMTGDVRIKMCIKPNEEDLTTIYHELGHVYYYLA
YNDLPPLFQSGANDGFHEAIGDTVVLALTPDYLQSVGLVGKQRQSEQAVINAQMRMALAK
VAFLPFGLMIDRWRWGVFDGSIAPDQYNSAWWDLKARYQGVAPATARDEAFFDPGAKYHV
PGNTPYTRYFLAHILQFQFYRALCDAAGYEGPLHACSFYGNKEAGQKFWSMLKKGQSQPW
PETLKELTGSGELDATAILDYFAPLQAWLKQQNQGRQCGW
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcaagctgctcgcggcggccctgctggccgcccttgccggagcctgcgcggcg
acggcgccacgcgacaagaccacccaggctgcgccgggtgccggcagcgaaagcgccgac
gccttcgtcggccgcgtcaacgacgcgttccgcgccacctcgcccgagatgaacgccgcg
caatggctggcggtgacctacatcaacgaggattcgcagctgctggcggccaagagcaac
gagcgcagcctcacccagctcaacgccttcgtcgaggaagcgcgccgctacgacggccag
gcgctgtccgccgacaccgcccgctcgatcgccctgctcaagctcgcgacggcgatgccc
gcgccgaaggatccggccaagctcgccgagctggcgcggatcgcgtccaagctcgaaggc
gcctacggggccggcacgtactgccgcgaccacgacggcaagcggcagtgccgccagctc
ggcgagctggaggacgtgctgcgcgacccgaaggccagctacgaggaccagctcgacgcc
tggaccggctggcacaccatcgcccagccgatgcgcgccgactaccggcgcttcgccgaa
ctggtcaacgaaggcgcgcgcgagatgggcttcgccgacgccggcgcgatgtggcggtcc
ggctacgacatggacccggatgcgttccgcgccgagaccgaccgtctctgggagcaggtc
aagccgctctacagcgacctgcagtgctacgtacgcggcaagctcgagaagaaatacggc
gcgcgcggccacgtggacggcctgctgccggcccacctgaccggcaacatgtggcagcag
gactggggcaacctctggccgatcctggaaccgtacaagggcgcgggcagcctggacatc
accggcgcgctggagaagcagcgcgccgccgagctgcgccggctgcgtgccggcttcaag
ggacgcgcgagcgccgaggacagcgtgcgtctggaacgcgaggcggacctcgccatcgcg
cgcagcatgaccgagcgtgccgaggacttctacacctcgctcggcatgccgaaacttccc
gagagcttctggaccaaggcgcagctggtcaagccgcgcgaccgcgacgtggtctgccac
gccagtgcctgggacatgaacatgaccggcgacgtgcgcatcaagatgtgcatcaagccc
aacgaggaagacctgacgacgatctaccacgagctcggccacgtctactactacctcgcc
tacaacgacctgccgccgctgttccagtccggcgccaacgacggcttccacgaggcgatc
ggcgataccgtggtgctggcgctcacgcccgactacctgcagtcggtcggcctggtcggc
aagcagcgccagagcgaacaggcggtcatcaacgcgcagatgcgcatggcgctggcgaag
gtcgcgttcctgccgttcggcctgatgatcgaccgctggcgctggggcgtgttcgacggt
tcgatcgcgccggaccagtacaacagcgcctggtgggacctcaaggcccggtaccagggc
gtggcgccggccacggcgcgcgacgaggcgttcttcgacccgggcgccaagtaccacgtg
cccggcaacacgccctatacgcgctacttcctcgcgcacatcctgcagttccagttctac
cgcgcgctctgcgacgccgccggctacgaaggcccgctgcacgcgtgcagcttctacggc
aacaaggaagccggccagaagttctggtcgatgctcaagaagggccagagccagccctgg
ccggaaacgctcaaggagctgaccggcagcggcgaactcgatgccaccgcgatcctcgac
tacttcgcaccgctgcaggcctggctcaagcagcagaaccagggccgccagtgcggctgg
tga

DBGET integrated database retrieval system