KEGG   Dokdonella koreensis: I596_1749Help
Entry
I596_1749         CDS       T04377                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dko  Dokdonella koreensis
Pathway
dko00010  Glycolysis / Gluconeogenesis
dko00071  Fatty acid degradation
dko00350  Tyrosine metabolism
dko00625  Chloroalkane and chloroalkene degradation
dko00626  Naphthalene degradation
dko01100  Metabolic pathways
dko01110  Biosynthesis of secondary metabolites
dko01120  Microbial metabolism in diverse environments
dko01130  Biosynthesis of antibiotics
dko01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I596_1749
  Lipid metabolism
   00071 Fatty acid degradation
    I596_1749
  Amino acid metabolism
   00350 Tyrosine metabolism
    I596_1749
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I596_1749
   00626 Naphthalene degradation
    I596_1749
Enzymes [BR:dko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     I596_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ANB17773
UniProt: A0A160DVH0
LinkDB All DBs
Position
complement(2011076..2012104)
Genome map
AA seq 342 aa AA seqDB search
MPKMMKAAVVRAFGQPLSIEDVPVPTPGAGEILVKIAACGVCHTDLHAAEGDWPVKPAPP
FIPGHEGVGHVVAVGAGVRHVREGDRVGIPWLYSACGTCPHCLGGWETLCESQRNTGYSV
NGGFAEYALADAAYVGHLPDGLDFVAAAPVLCAGVTVYKGLKVTDTKPGQWVVVSGVGGL
GHMAVQYARAMGLQVAAVDVDDAKLALARTLGATVTVNARTTDPAAYLKQTIGGAHGALV
TAVSPKAFEQALGMVRRGGTVSLNGLPPGDFPLSIFDMVLNGITVRGSIVGTRLDLEESL
AFAARGAVKATVTTDRLDNINEVFDRMRQGRIEGRVVLDLAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatgatgaaagccgccgtcgtgcgcgcgttcggccagccgctgtcgatcgag
gacgtgccggtcccgacaccgggtgccggcgagatcctcgtgaagatcgccgcctgcggc
gtctgccataccgacctgcacgcggccgagggcgactggccggtgaagccggcaccgccg
ttcatcccgggccacgagggcgtgggccatgtcgtggcggtgggcgccggtgtccgccac
gtgcgcgagggcgatcgcgtcggcatcccgtggctgtactcggcctgcggcacctgcccg
cactgcctcggcggctgggagacgctgtgcgagagccagcgcaacaccggctattcggtc
aacggcggcttcgccgaatacgcgctggcggatgcggcctacgtcggccacctgccggat
gggctggacttcgtcgcggcggcaccggtgctgtgcgcgggggtcacggtctacaagggc
ctcaaggtcaccgacacgaagcccggccagtgggtggtggtctccggcgtcggcggcctg
ggccacatggcggtgcagtacgcacgcgcgatgggcctgcaggtggcggcggtggacgtg
gacgatgccaagctggcgctggcgcgcacgctgggcgcgacggtgacggtcaacgcgcgg
acgaccgatccggcggcgtacctgaagcagacgatcggcggcgcgcacggcgcgctggtg
acggcggtgtcgcccaaggccttcgagcaggcgctgggcatggtccgccgcggcggcacg
gtgtcgctcaacggcctgccgccgggcgacttcccgctgtcgatcttcgacatggtgctc
aacggcatcaccgtgcgcggctcgatcgtcggcacgcggctggacctggaggaatcgctc
gcgttcgcggcgcgcggcgcggtcaaggccacggtgacgaccgaccggctcgataacatc
aacgaggtgttcgaccggatgcgccaggggcgcatcgaaggccgcgtggtgctggacctg
gcggcctga

DBGET integrated database retrieval system