KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10045Help
Entry
Dmel_CG10045      CDS       T00030                                 

Gene name
GstD1
Definition
(RefSeq) glutathione S transferase D1, isoform B
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00480  Glutathione metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG10045 (GstD1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG10045 (GstD1)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG10045 (GstD1)
   00983 Drug metabolism - other enzymes
    Dmel_CG10045 (GstD1)
Enzymes [BR:dme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dmel_CG10045 (GstD1)
Transporters [BR:dme02000]
 Other Transporters
  Pores ion channels [TC:1]
   Dmel_CG10045 (GstD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_C_3 GST_N_2 DnaJ
Motif
Other DBs
NCBI-GeneID: 41503
NCBI-ProteinID: NP_001034042
FlyBase: FBgn0001149
UniProt: P20432
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3R
AA seq 209 aa AA seqDB search
MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNG
FALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAK
APADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANV
NRWYENAKKVTPGWEENWAGCLEFKKYFE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggttgacttctactacctgcccggctcctccccctgccgctccgtgatcatgaccgcc
aaggccgtgggcgtcgagctgaacaagaagctgctcaacctgcaggccggtgagcacctg
aagccggagttcctgaagatcaatccccagcacaccattcccacgctggtggacaacgga
ttcgcgctgtgggagtcccgcgccatccaggtgtatttggtggagaagtacggcaagacc
gactccctgtaccctaagtgccccaagaagcgcgccgtgatcaatcagcgcctgtacttc
gacatgggaacgctgtaccagagcttcgccaactactactacccacaggtgttcgccaag
gcgcccgccgatccagaggccttcaagaagatcgaggccgccttcgagttcctgaacacc
ttcctggagggacaggactacgccgccggtgactcccttaccgtagccgacattgccctg
gtggcaaccgtgtccacattcgaggtggccaaattcgagatcagcaagtacgccaatgtg
aacaggtggtacgagaacgccaagaaggtgactcccggatgggaggagaactgggccgga
tgcctggagttcaagaagtacttcgaataa

DBGET integrated database retrieval system