KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6502Help
Entry
Dmel_CG6502       CDS       T00030                                 

Gene name
E(z)
Definition
(RefSeq) enhancer of zeste, isoform B
  KO
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dmel_CG6502 (E(z))
Enzymes [BR:dme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dmel_CG6502 (E(z))
Chromosome [BR:dme03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dmel_CG6502 (E(z))
   Polycomb group proteins
    PRC2-EZH2 complex
     Dmel_CG6502 (E(z))
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
3L
AA seq 760 aa AA seqDB search
MNSTKVPPEWKRRVKSEYIKIRQQKRYKRADEIKEAWIRNWDEHNHNVQDLYCESKVWQA
KPYDPPHVDCVKRAEVTSYNGIPSGPQKVPICVINAVTPIPTMYTWAPTQQNFMVEDETV
LHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSYSKELE
EAAPGTATAIKTETLAKSKQGEDDGVVDVDADGESPMKLEKTDSKGDLTEVEKKETEEPL
ETEDADVKPDVEEVKDKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQDPERPQE
CTPNIDGIKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKPFA
EPCSNSCYMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNHENSKDNGL
TVNSAAVAEINSIMAGMMNITSTQCVWTGADQALYRVLHKVYLKNYCAIAHNMLTKTCRQ
VYEFAQKEDAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDH
PGHPCDMNCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLC
QACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEII
SQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDH
RIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcactaaagtgccgcccgagtggaagaggcgtgtcaagtcggagtacatcaaa
atcaggcagcagaagcgctacaaacgtgccgacgagatcaaggaggcgtggataagaaac
tgggacgagcacaaccacaatgtacaggatctgtactgcgagtcgaaggtttggcaggct
aaaccctacgatccgccgcatgtggactgtgtgaagcgggcggaggtgactagctacaat
ggcattcccagcggtccgcaaaaggtgcccatttgcgtgatcaacgcggtcactcccata
cccaccatgtacacgtgggcaccaacacagcagaacttcatggtggaggatgagacggtg
ctgcacaatataccctatatgggcgacgaggtcctcgataaggatggcaagttcatagag
gaactgatcaaaaactacgatggcaaggttcacggcgacaaggatccctcgttcatggac
gatgccatcttcgtagaactggtgcacgcccttatgcgctcctacagcaaggaactggag
gaagccgctccgggtacagcgactgccattaaaacagagacgttggcgaaatcaaaacag
ggcgaagatgatggggtagttgatgttgacgcagatggtgaatctcccatgaagcttgag
aaaaccgacagcaaaggggatctgactgaagttgagaagaaggaaactgaagaaccgctg
gagactgaagatgcggatgttaagcccgatgtggaagaagtcaaggacaagctgcccttc
cctgcgcccattatttttcaggccatcagcgctaactttccagacaagggcaccgcgcaa
gagctcaaagaaaagtacattgagcttacggagcaccaggatccggagcgcccacaggag
tgcacacccaacattgacggcatcaaggccgagagcgtttcccgggaaaggactatgcac
tcctttcacacgctcttctgtcgtcgttgcttcaaatacgactgcttcctgcaccgcttg
caaggacatgcgggtcccaatctccagaagcgtcgctatccggaactgaagcctttcgcc
gaaccttgcagcaactcctgctacatgttgatcgatggcatgaaggaaaagctggcggcc
gatagcaagacacctcccattgattcctgcaatgaggccagctccgaggacagtaatgac
agcaacagtcagtttagcaacaaggactttaatcatgagaatagcaaggataatggcctg
actgtaaatagcgccgctgtggctgagatcaactccattatggctggcatgatgaacatc
accagtacgcagtgcgtttggacaggcgctgaccaagcactttatcgggtcttgcataaa
gtgtatttaaagaactactgcgcgattgcgcacaacatgctgaccaagacctgtcgtcag
gtgtacgagtttgcccagaaggaggatgctgagtttagcttcgaggatttgcgacaggac
ttcacacctccgcgcaagaagaagaagaagcaacgtctgtggtcgctgcactgtcgtaag
attcagctaaagaaggactcatcctcgaatcacgtgtacaactacacgccctgcgaccat
cccggacatccatgcgacatgaactgctcctgcattcagacacaaaacttctgcgaaaag
ttctgcaactgcagcagcgattgccagaatcgtttccccggctgtcgctgcaaggctcag
tgcaatacgaagcagtgtccttgctatctggcagtgcgcgagtgtgatcccgatctgtgc
caggcctgcggagcggatcagtttaagctgaccaagatcacgtgcaagaacgtgtgcgtg
cagcgaggactgcacaagcacctgctcatggctccgtctgacatcgccggctggggcatc
tttcttaaggagggtgcgcaaaagaatgagttcatttcggaatattgtggcgagatcata
tcccaagatgaagccgatcgccgtggcaaggtttacgacaagtacatgtgctcatttctt
ttcaatctgaacaacgattttgttgtggatgccactcggaagggcaacaagattcggttt
gccaatcattccattaatcccaattgctatgccaaggttatgatggtcaccggcgatcat
cgcatcggcatctttgccaagcgggccattcagcccggcgaagagctattctttgactac
agatacggacccacggagcagctgaagttcgtgggcatagagcgtgaaatggaaattgtt
tga

DBGET integrated database retrieval system