KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7433Help
Entry
Dmel_CG7433       CDS       T00030                                 

Gene name
Gabat
Definition
(RefSeq) gamma-aminobutyric acid transaminase, isoform C
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00250  Alanine, aspartate and glutamate metabolism
dme00280  Valine, leucine and isoleucine degradation
dme00410  beta-Alanine metabolism
dme00640  Propanoate metabolism
dme00650  Butanoate metabolism
dme01100  Metabolic pathways
Module
dme_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dmel_CG7433 (Gabat)
   00650 Butanoate metabolism
    Dmel_CG7433 (Gabat)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dmel_CG7433 (Gabat)
   00280 Valine, leucine and isoleucine degradation
    Dmel_CG7433 (Gabat)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dmel_CG7433 (Gabat)
Enzymes [BR:dme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Dmel_CG7433 (Gabat)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Dmel_CG7433 (Gabat)
Amino acid related enzymes [BR:dme01007]
 Aminotransferase (transaminase)
  Class III
   Dmel_CG7433 (Gabat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 40188
NCBI-ProteinID: NP_001163479
FlyBase: FBgn0036927
UniProt: Q9VW68
LinkDB All DBs
Position
3L
AA seq 486 aa AA seqDB search
MRSLWLNTLTKQSLYRLSTKRYSTNVEPKEPVVKTKSIPGPKSIELKKQLDSVQATGTIQ
FFADYEKSIGNYIYDVDGNILLDVYTQISSVPLGYNHPRLYKVFNNEQNLKTLINRPALG
VFPGKEWPEKLHSVLLNIAPKGLNKITTMMCGSCSNENAYKSIFIWYQNKLRGNAPLTEQ
EKNSCMINIPPGAPKLSILSFKGAFHGRTLGALSTTHSKYIHKLDVPSFDWPIASFPEYR
YPLDENVAHNKKEDEKCLSEVQDLIQQYASKNPVAGIVVEPIQSEGGDNEASPEFFRSLQ
AICKKNGIALLIDEVQTGGGSTGKFWAHEHFELESPPDVVTFSKKLQLGGYFHNDDFIPN
EPYRIFNTWMGDPGKVLLLEEVVKVIQEEKLLANVDVAGKVLKNGLLSLEKEFPHILNST
RGRGTFLAVNCTNTKVRDQIIGALKLHGIQTGGCGEISIRFRPALIFKEYHANIVLDRFR
KVLQGI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcggagcttgtggctaaatacgttgaccaagcagagtctatataggctgagtaccaag
aggtactccaccaacgttgagcccaaggagcctgtagtgaaaaccaaatcgatacctggc
cccaaatcgattgagcttaagaagcaactggattctgttcaggccaccggaacgatccaa
ttcttcgctgactacgagaagtccattggaaactacatctacgacgtggatggcaacatt
ctactagatgtctacacccagatttcctcagttccattgggttacaaccatccgaggctc
tacaaggtctttaacaatgagcaaaacctgaaaacattgattaaccgacctgcacttggt
gtcttccctggcaaggaatggccggaaaaactgcactcagttctcttgaacatagctccg
aaaggactcaataaaatcacaaccatgatgtgtggttcatgctcgaatgaaaatgcctac
aagagcatcttcatatggtaccagaacaaacttcgtggtaatgcacctcttaccgagcag
gagaagaactcctgcatgattaacattcccccaggagccccgaaactcagtattctctca
ttcaagggagccttccatgggcgaacattgggagccctgtccaccacacattcgaagtac
atccataagttggacgttccatctttcgactggcccattgcctcgtttcccgagtatcga
tatcccctggacgaaaacgtggcgcacaacaagaaggaggacgaaaagtgccttagcgaa
gtgcaggatctcattcagcagtacgccagcaagaatccggttgccggaatcgtcgttgaa
ccgattcagagcgaaggaggcgacaacgaggcatcgcccgagttctttcggagcctccag
gctatttgcaagaagaatggcatcgcccttctgatcgatgaggtccaaaccggtggaggt
agcactggaaaattctgggcccacgagcacttcgagttggagagtcctcccgatgtggtg
accttcagcaagaagctgcagttgggtggctacttccacaacgacgacttcattccgaat
gagccgtacaggatcttcaacacctggatgggcgatccgggcaaggtcctcctgctcgag
gaagtcgtgaaggtcatccaggaggagaagctcctggccaatgtcgacgtggccggcaag
gttctgaagaacggtttgctgagcctggagaaggaattcccgcatatcttgaactccacc
cgcggtcgtggaaccttcttggcagtcaactgcaccaacaccaaggtgcgagatcaaatt
atcggcgcactcaagttgcacggcattcagaccggtggctgtggggaaatttccattaga
ttccgcccagctttgatatttaaggaataccatgccaacatcgtcctcgatcgcttccgc
aaggttcttcaaggtatttaa

DBGET integrated database retrieval system