KEGG   Desulfococcus multivorans: Dmul_14570Help
Entry
Dmul_14570        CDS       T04568                                 

Gene name
fadD2
Definition
(GenBank) FadD2: putative fatty-acid--CoA ligase
Organism
dml  Desulfococcus multivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1655234..1658125
Genome map
AA seq 963 aa AA seqDB search
MTTHAGPAFPGKRDKTASAGSMHRDRPGTSPAGLGTEAEAVCRLAAQLAGEMDPGRKNLR
VELDSSLERDLGFDSLARMELLSRLEKAWGVSLSEEVLIAAETLRDLVRALGLGTARIQV
LEDRRRPVSEQDIRRGAIADEARTLVEMLQLQAARSPDRLHLLLTSGAEEPVEVSYGRLF
DGAAAVAAGLCGLGLQPGANVALMLPTGLDYFFSFFGILLAGAVPVPLYPPARPSQFEDH
LRRHRHILNNCQARMLITVAEARPLARFLKTQVASLDRVVTADGLQGTGGAGILPPVLPE
ETAFLQYTSGSTGIPKGVILSHANLMCNIRAMGRAMEVTPEDVFVSWLPLYHDMGLIGAW
LGSLYHGCRLVIMPPLSFLAHPERWLWAIHHHRGTLSAAPNFGYELCLKRFDEQLLEGLD
LSSWRLAFNGAEPVSPETITRFTRRFACYGFRSEAMAPVYGLAECTVGLAFPPVGRGALI
DRVRREPMMKRGEAVPAPDDDPNPLRVVACGRPMAGHQVRVVDGQDRELPQRREGRLQFS
GPSATSGYFRNPRETAALFHGEWLDTGDLAYMAERDIYITGRVKDIIIKGGRNISPYELE
EAVGDINGIRKGCVAVFGVEDSASATEKLVVLAESRDQAADVLAGLKKRIVNAAVDILGM
PPDEVILVPPGTVLKTSSGKIRRAASRELYKKGRIEQGPRAVWWQLARLTAGGILRQAGR
WMRQAASTGYAGYCWLLFMVLGALAAPLVFLLPWRGGRRRVARTVARLLARLTGTPIVVR
GLEHLQTEEPLILVANHQSYMDSIVLIAALPMRFGFVAKAELAENVVLRRVLTRLDVVFV
ERFDSRQAIEDVRRIEKLAAAGQSLLFFPEGTFRRMPGLLPFHMGAFLIAADNNLAVVPI
AIRGTRSKLLPETWFPRRGPVHIFIGRPLRGEGPGWASALDLREAARRQILLHCGEPDQG
GDA
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacatgcaggtcccgcctttccgggaaaaagagacaagacagcttccgccgga
tccatgcaccgggatcgtcccgggaccagccccgccggtttgggaacggaagccgaggcc
gtctgtcggctggccgcccaactggccggagagatggatcccggccgcaaaaaccttcga
gtcgaactggacagctccctggagcgcgatctgggcttcgacagcctggccaggatggag
ctgctgtcgcgactggaaaaagcctggggagtgtcgctgagcgaagaggtgctgatcgcc
gctgaaaccctgagagacctggtccgggcattgggtctggggacggcacggatccaagtc
ctggaagacaggcgccggcctgtgtcggagcaggatatccgacggggagcgattgccgat
gaagcccggaccctggtagagatgctgcagcttcaggcggccagatcgccggatcggttg
caccttctcctgacctccggagcggaagaacccgttgaggtcagttacggccgactcttc
gacggagccgccgccgttgccgccggtctgtgcggactgggtctccagcccggggccaat
gtggcgttgatgctgcccaccggacttgattattttttcagtttcttcggcattcttttg
gccggggctgttccggtccccctttacccgcccgcacgaccttcccaattcgaggaccat
ctgcgccgccacaggcacattctcaacaactgccaggcccggatgctgattactgtcgcc
gaggccaggcccctggcgcgctttcttaaaacccaggtggcctctctggatcgggttgtc
accgccgacggactgcagggcacaggcggcgccggcatcctgccgccggtgttgcccgag
gaaaccgcttttctccagtacacctcgggcagcaccggcatccccaagggggttatcctc
agtcatgccaacctgatgtgcaatatcagggcgatggggcgggcgatggaagtcactccg
gaagatgtctttgtgagctggctgcccctttaccatgacatgggcctgatcggagcctgg
ctgggcagcctctatcacggctgccggttggtcatcatgccgcccttgtcgtttctggca
catccggaacgatggttgtgggccatccaccaccaccgaggcacgctgtcggccgccccc
aactttggttacgagctgtgcctgaaacggttcgacgaacagcttctggagggtctggat
ctgagttcctggcggctcgccttcaacggcgccgaacccgtcagcccggagacgattacc
cgttttacgcgtcgattcgcctgctatggattccggtccgaggcgatggcacccgtttac
ggccttgccgagtgcaccgtcggccttgcctttccgccggtgggacggggggctcttatt
gatcgtgtccgccgcgagccgatgatgaagaggggcgaggcggtgccggccccagacgac
gaccccaatccgcttcgtgttgttgcctgcggtcgcccgatggccggacatcaggtacgg
gttgtcgatggccaggaccgtgagctgcctcaacgccgcgaaggccgcctccaattctca
ggaccctcggccaccagcgggtatttccgcaatccccgggagaccgcagccctgttccac
ggcgagtggctcgataccggcgatctggcctatatggccgaacgggacatttacatcacc
ggcagggtcaaggatatcattatcaagggcggtcggaacatttccccgtatgagcttgaa
gaggccgtcggcgatatcaacggcatccgaaaaggttgcgttgctgtcttcggcgtggag
gattcggcttccgccacggaaaaattagtagtgctggcggagagccgcgatcaggccgcc
gacgtattggctggtctcaagaagcggatcgtaaacgcggcggtcgatatcctgggcatg
cccccggacgaggtgattttggtcccgcccggcaccgtccttaagacctccagtggaaag
atccgcagggctgcgagccgggagctctacaagaagggccgtatcgagcaggggccccgg
gctgtgtggtggcagctggctcgcctgaccgccggcggaatcctgcggcaagccggccgg
tggatgcggcaggcggcctcaaccggctatgccggttattgctggctgctctttatggtg
ctgggagcgttggcggcccctctcgtattcttgttgccgtggcgcggcggacgccggcgc
gtagcccggacggtggcccggctgctggcccgcctcaccggcacgcccatcgtggtccgc
ggtctggagcatctgcagacggaagagccgctgattctggtcgcgaatcatcagagctat
atggacagcatagtgctgatagcggcgctgccgatgcgatttggttttgtcgccaaggcc
gagttggccgaaaacgtcgttttacgtcgggttctgacccgcctcgatgtggtctttgta
gagcggttcgacagtcgccaggccatagaggatgtccgaaggatcgagaagcttgccgct
gccggacagtcgcttctgttcttccccgagggcaccttccgacggatgcccgggctgctg
ccgtttcatatgggtgcgtttctgatcgctgcggataacaatctggcggtggtgcccatc
gccatccgggggacgcggtctaaattgctccccgaaacgtggtttccgcggcggggcccg
gtgcatatctttatcggtcgtcctctccgaggagagggaccgggttgggcgtcggccctc
gatctgcgcgaagcggcacgacggcagatcctgcttcactgcggcgagccggatcagggt
ggggatgcataa

DBGET integrated database retrieval system