KEGG   Drosophila mojavensis: Dmoj_GI11974Help
Entry
Dmoj_GI11974      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00310  
pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dmo  Drosophila mojavensis
Pathway
Glutathione metabolism
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmoj_GI11974
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmoj_GI11974
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     Dmoj_GI11974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MSSGRHLAKGSGTPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPDW
LFEKNPEGKVPALELVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQEKLLIER
FGPVLGAFFKASDGGDLEPFWSGLDIYERELSRRGTLFFGGEQTGILDYMIWPWCERLEL
LQLQRGDDYNYDEKRFPKLTEWRERMKRDPAVMAFYMEAEVQAEFLRTRSAGKPNYNLLV
KDA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggcagacacttggcaaaaggctctgggacgcccgatgtgcctgaggatggc
atcttaaggctctactccatgcgcttctgcccctttgcccagcgcgtgcatctggtgtta
gatgccaaacagataccctatcacagcatttatataaacctcacagataagccagattgg
ctgttcgaaaagaatcccgagggcaaggttccagcgctggagctagtgcgcgagccaggt
ccgcccgtccttaccgagtcgctgctcatatgcgagtacctggacgagcagtatccactg
cgtccgctctacccacgtgatccgctgaaaaaggtgcaggagaagctgctcatcgaacgc
tttggtcccgttctcggcgccttcttcaaggcctctgatggcggcgacctggaaccgttc
tggagtggcctcgacatatacgagcgagaactgagcaggcgtggcacactcttctttggc
ggcgaacagacgggcatattggattacatgatctggccctggtgtgagcgactagagctg
ctacagctacagcgtggcgacgactacaactatgacgaaaaacgttttccaaagctgacg
gaatggcgagagcggatgaaacgtgatcctgctgtgatggccttctatatggaagccgag
gtgcaggccgagttcttgcgcacgcgcagcgccggcaaacccaactacaatcttttggtc
aaggatgcctaa

DBGET integrated database retrieval system