KEGG   Deinococcus maricopensis: Deima_0677Help
Entry
Deima_0677        CDS       T01412                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dmr  Deinococcus maricopensis
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Deima_0677
Enzymes [BR:dmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Deima_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
768394..769950
Genome map
AA seq 518 aa AA seqDB search
MTTDPRTTTLNALNAHEPWDVLVIGGGASGLGAAVEAATRGYKTLLVEAFDYAKGTSSRS
TKLVHGGVRYLAQGNVSLVREALRERGLLRRNAPHLVRDLGFVVPAYDWWAGPFYGIGLK
LYDVLAGKLNLGHSKLLDRDAALARTPTLQREGLRGGILYFDGQFDDARLAITLLRTFED
HGGVALNHAPVTGLIKDNGKVVGARLRDAETGQEHEVRARAVINATGVFVDAIRRMDNPE
TPDMLSPSQGVHVVVDRKFLPGDSAIMIPRTDDGRVLFAVPWHDHVVIGTTDTPVPEASL
EPKPLPEEIEFILRTAGRYMDPAPTRDDVRSVYVGLRPLVKAETTDGAGSTAQLSRDHVI
RISDSGLVTLTGGKWTTYRRMGEDAVDRAARIAELPERLTVTPALHLHGWSEDDRPDHWK
VYGTDAPHVQALPGATTPLHPDLPYTEAEVRWAARKEQARTVEDVLSRRTRAILLNARAS
SEAAPKVAAILAEELGRDAQWQAAQVHDYQTLAQQYQL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacccccgcaccaccaccctcaacgccctcaacgcccacgaaccctgggac
gtcctcgtcatcggcggcggcgccagcggcctcggcgccgccgtcgaagccgccacccgc
ggctacaagaccctgctcgtcgaagcgtttgattacgccaaaggcaccagcagccgcagc
accaaactcgtgcacggcggcgtccgctacctcgcgcagggcaacgtcagcctggtgcgc
gaagccctgcgcgaacgcggcctgctgcgccgcaacgccccccacctcgtccgcgacctc
ggcttcgtcgtccccgcctacgactggtgggccggccccttctacggcatcggcctcaag
ctctacgacgtcctcgccggcaaactcaacctcggccacagcaaactcctcgaccgcgac
gccgccctcgcccgcacccccaccctccaacgcgaaggcctgcgcggcggcatcctctac
ttcgacggacaattcgacgacgcccgcctcgccatcaccctgctgcgcaccttcgaggac
cacggcggcgtcgccctcaaccacgcccccgtcaccggcctcatcaaggacaacggcaaa
gtcgtcggcgcccgcctgcgcgacgccgaaaccggccaagaacacgaagtccgcgcgcgc
gccgtcatcaacgccaccggcgtgttcgtcgacgccatccgccgcatggacaaccccgaa
acgcccgacatgctcagccccagccagggcgtgcacgtcgtcgtggaccgcaaattcctg
cccggcgacagcgccatcatgatcccccgcaccgacgacggccgcgtcctgttcgccgtg
ccctggcacgaccacgtcgtcatcggcaccaccgacacccccgtccccgaagccagcctc
gaacccaaacccctccccgaagaaatcgagttcatcctccgcaccgccggacgctacatg
gaccccgcccccacccgcgacgacgtccgcagcgtctacgtcggcctgcgccccctcgtg
aaggccgaaaccaccgacggcgccggcagcaccgcgcaactcagccgcgaccacgtcatc
cgcatcagcgacagcggcctcgtcacgctcaccggcggcaaatggaccacctaccgccgc
atgggcgaagacgccgtggaccgcgccgcccgcatcgccgaactgcccgaacgcctcacc
gtcacgcccgccctgcacctccacggctggagcgaagacgaccgccccgaccactggaag
gtctacggcaccgacgccccccacgtgcaggccctgcccggcgccaccacccccctgcac
ccggacctcccatacaccgaagcggaagtccgctgggccgcccgcaaggaacaggcccgc
accgtcgaggacgtcctctcacgccgcacccgcgccatcctcctgaacgctcgcgccagc
agcgaagccgcccccaaagtcgccgcgatcctcgccgaggaacttggccgcgacgcgcag
tggcaggccgcccaggtccacgactaccagacgctcgcgcagcagtaccagctgtag

DBGET integrated database retrieval system