KEGG   Deinococcus maricopensis: Deima_0786Help
Entry
Deima_0786        CDS       T01412                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
dmr  Deinococcus maricopensis
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deima_0786
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deima_0786
   00620 Pyruvate metabolism
    Deima_0786
   00630 Glyoxylate and dicarboxylate metabolism
    Deima_0786
  Energy metabolism
   00680 Methane metabolism
    Deima_0786
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Deima_0786
Enzymes [BR:dmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Deima_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
876325..877311
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQIGYSLLFRIAAGDMLGKDQPVILQLLEITPALKALQGVVMELRDC
AFPLLADIVTSDDPKVAFKDADYALLVGAMPRKAGMERGDLLSANGGIFKPQGEALAEVA
SRNVKVLVVGNPANTNALIAQQNARGLDPKQFTAMVRLDHNRAISQLAERTGKPVSSIKN
LTIWGNHSSTQYPDLAHATVDGQPALEAVNDQAWYENEYIPTVAKRGAAIIEARGLSSAA
SAASAAIDHMRDWALGTADGEWVSMGIPSDGSYGIPEGLIYGFPVTVKNGEYTIVQGLDV
SDFSRGKMDATAQELEEERQAVRDLGLI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacctgtacgcgtcgccgttaccggcgctgccggccagatcggctacagcctg
ctcttccgcatcgccgcgggcgacatgctcggcaaggaccagccggtcatcctgcaactc
ctcgaaatcacgcccgccctcaaggccctgcagggcgtcgtgatggaactccgcgactgc
gcgttcccgctcctcgcggacatcgtcaccagcgacgaccccaaggtcgcgttcaaggac
gccgactacgcgctgctcgtcggcgccatgccccgcaaggccggcatggaacgcggcgac
ctgctgagcgccaacggcggcatcttcaaaccccagggtgaagcgctcgccgaagtcgcc
agccgcaacgtcaaggtcctcgtcgtcggcaaccccgccaacacgaacgccctcatcgcg
cagcagaacgcccgcggcctggaccccaagcagttcacggccatggtgcgcctcgaccac
aaccgcgccatcagccagctcgccgagcgcaccggcaagcccgtgagcagcatcaagaac
ctcaccatctggggcaaccacagctccacgcagtacccggacctcgcccacgccaccgtg
gacggccagcccgccctcgaagccgtgaatgaccaggcgtggtacgagaacgagtacatc
cccacggtcgccaagcgtggcgccgccatcatcgaggcgcgcgggctcagcagcgccgcg
tccgccgcgagcgccgccatcgaccacatgcgcgactgggcgctcggcacggctgacggc
gagtgggtcagcatgggcatccccagcgacggcagctacggcatccccgagggcctgatc
tacggcttccccgtcaccgtcaagaacggcgagtacaccatcgtgcagggcctcgacgtc
agcgacttcagccgcggcaagatggacgcgaccgcgcaggaactcgaagaagagcgccag
gctgtgcgcgacctcggcctgatttaa

DBGET integrated database retrieval system