KEGG   Dehalococcoides mccartyi CG1: X792_03965Help
Entry
X792_03965        CDS       T03647                                 

Definition
(GenBank) DNA ligase D
Organism
dmx  Dehalococcoides mccartyi CG1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
730587..731141
Genome map
AA seq 184 aa AA seqDB search
MPSNPLEEYNRKRNFAKTAEPSGVRSALSVQPVFVVQKHLASRLHYDFRLEIDGVLKSWA
VPKGPSASPKEKRLAVPTEDHPMQYASFEGVIPAGEYGAGQVIVWDRGTFTNLKAGKTLA
ESYDTGHLVIELQGEKLRGGYSLLRTKMGWLMVKMEDAFARPLSNILDEQPASVISGKLV
EDIT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaccctctggaagaatataaccgcaaacgtaattttgctaaaactgctgaa
ccttctggtgtacgaagtgcactctctgtacagccagtatttgttgtccaaaaacacctt
gccagccgcctgcactatgatttcagactggaaattgatggggttttaaaatcatgggct
gttcccaaagggccatctgccagccccaaagaaaaacggctggctgtgcctaccgaagac
catcccatgcagtacgcctcttttgaaggtgtaataccggcgggtgaatacggggcgggg
caggtgatagtctgggatagaggcacttttacaaaccttaaagcaggaaaaacactggca
gagtcttatgacacaggacatctggtaatagaacttcagggtgaaaaactcagaggcgga
tattcgcttttacggactaaaatgggctggttgatggtgaagatggaagatgcatttgcc
cgcccgttgtcaaatatacttgatgaacaaccggcttcggtgataagcggaaaattggtt
gaagatattacttaa

DBGET integrated database retrieval system