KEGG   Dehalococcoides mccartyi CG5: X794_02545Help
Entry
X794_02545        CDS       T03649                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dmz  Dehalococcoides mccartyi CG5
Pathway
dmz00550  Peptidoglycan biosynthesis
dmz01100  Metabolic pathways
dmz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dmz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    X794_02545
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    X794_02545
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    X794_02545
Enzymes [BR:dmz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     X794_02545
Peptidoglycan biosynthesis and degradation proteins [BR:dmz01011]
 Precursor biosynthesis
  Amino acid ligase
   X794_02545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C CPSase_L_D2 GARS_A ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter RimK TTL
Motif
Other DBs
NCBI-ProteinID: AII60726
LinkDB All DBs
Position
484030..485046
Genome map
AA seq 338 aa AA seqDB search
MRIGLSYDLKLALTPVTGGPDDALEEYDSPETVEAITNSLTAAGHAVYRLGGGKEFLRKV
QEQKLDLVFNISEGLGNYRSREAQIPGVLEMLDIPYTGSDPQTLAICLDKPLTKKLVAGA
GVKTAKWQLVSNCEELSTIDWSDFPLPAFLKPACEGSSKGVRFASRAESTDEIMRMATEL
LTTYNQPVLVEEFINGDEITVGVIGNDKPKVLGIMRIVPKTKADYFVYSIEIKRNWRQMV
EYEVPAALPAKTLARIEKATLDAYRVLECHDLCRMDFRVSPDGTPYFLEVNPLPGLNPVS
GDLPIMASKLGISHADLVLEILNTAIARHNLVAADCLA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatagggctgtcatacgatcttaaactggctttgaccccggtaaccggcggccct
gatgatgcgttggaggaatatgactcaccggaaacggtggaggctataacgaactcctta
acagcggctggacatgctgtttaccgtttgggtggaggtaaagaatttttacgcaaggta
caggaacagaaactggatcttgttttcaatatttcagaaggtttgggtaactaccgcagc
cgcgaagctcaaattcccggtgttttagagatgttagatataccttacaccggttcagac
ccgcagacactggcaatctgtctggataaaccactaaccaagaaattggtggctggtgcg
ggcgtaaagactgccaaatggcagttggttagcaactgtgaagagctttcaaccatagac
tggtcggatttccctttgccggctttcctgaaaccagcctgcgagggttccagcaagggt
gtgcggtttgcttcccgggcggaaagtaccgacgagataatgaggatggctacagaactt
ttaactacctataaccaacctgttttggtagaggaatttataaatggcgacgaaattacg
gtaggtgttatagggaacgataagcctaaagttctgggtataatgcggattgtgcctaaa
accaaagccgattattttgtgtattccattgagataaaacgcaactggcggcagatggta
gagtatgaagtaccggcggccttacctgccaaaactctggcccgtattgaaaaagccaca
ctggatgcgtatagagtactggaatgccatgatctatgccggatggattttagggtaagc
ccggatggtacgccgtattttctggaggttaacccgcttcccggtcttaaccctgtcagc
ggagatttacctattatggcatctaaattaggtatcagccacgcagatttggtgttagaa
atacttaacactgccattgcccgccataatttggtagcggcagactgtttggcctga

DBGET integrated database retrieval system