KEGG   Diuraphis noxia (Russian wheat aphid): 107162312Help
Entry
107162312         CDS       T04900                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Brite
Enzymes [BR:dnx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     107162312
Peptidases [BR:dnx01002]
 Metallo Peptidases
  Family M2
   107162312
Exosome [BR:dnx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107162312
CD molecules [BR:dnx04090]
 Proteins
  107162312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 107162312
NCBI-ProteinID: XP_015364631
LinkDB All DBs
Position
Unknown
AA seq 548 aa AA seqDB search
MWEETVKYPWSTYKNXDIKRQFKLMSVLGTDALPEGKLKKLDEIVSTMESLYGRATIPEY
GDNNSNRSLSLEPDINDVLDKSTDVNELKHVWVQWREATGKKVRPMYAEYVRLSNEAARL
NNYTDAAEFWIRGYDVDDFRPRMERIWNQIKPLYLQIHAYVRRKLRELYGDSVVTRRGPI
PAHLLGDMWAQSWERLDDFTRPYPTIDDVNPTSAMINQNYTPKKMFKVAEEFFTSLNLSA
MPQTFWDKSILEKPNGRDLVCHASAWDFYDSNDFRIKQCTSVNFMDFITAHHEMGHIQYF
LQYKDQPFIYREGANEGFHEAIGDTIALSVSTPKHLHKIGLLPKTSRTYEADINYLYKIG
LDKIVFLPFGYLMDLWRWNVFKGITTEDQYNCDWWKLKYSYQGIEPPVTRTENDFDPGSK
YHIVGSVPYIRYFVSFIVQFQFHQALCEKAGQFDPKNPTSKPLHECDIYQSTNAGNAFKE
MLKLGSSKPWFDAMELLTGQREMDAGPLLNYFSPLYEWLQNENKRTGEHLGWETNKKICL
KKGETSQP
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaagaaactgttaaatatccatggtcaacatacaaaaatktagatatcaaaaga
cagttcaaattaatgtcagttctaggaacagacgctttacccgaaggcaaattgaaaaag
ttagatgaaatcgtttcgaccatggaaagtttgtacggcagagcaaccattcctgaatac
ggagacaacaattcaaatcgctctttgagtttggaaccagatataaatgacgtattggat
aaaagcactgatgttaatgagctgaaacatgtgtgggtacagtggagagaagccacggga
aaaaaagttcgacctatgtatgcggaatacgtaagactgtccaacgaagcggccagatta
aacaattatacagatgctgcagaattttggattcgaggatatgacgtcgacgactttcgg
ccgcgaatggaacgtatatggaatcagatcaaacctctatacttacaaatacacgcctac
gtacgcagaaagcttagggagttatacggtgattcggtggtmacgagaagaggacctata
ccagcacatctgctcggtgatatgtgggcgcagtcgtgggaacgtttggatgattttact
cgaccctatccaaccattgacgatgtaaaccccacctcagccatgataaatcagaactac
actccgaaaaaaatgtttaaagtggccgaagagtttttcacatcgttaaacttgagcgca
atgccccaaactttctgggataaatctattttggagaaaccaaatggtcgtgatttggta
tgccatgcatcagcttgggacttttatgattctaatgactttagaattaaacaatgcaca
tcggtaaattttatggattttataactgcccaccacgagatgggacacatccaatatttc
ctacaatacaaagaccaaccgttcatataccgcgaaggagctaacgaaggttttcatgaa
gcaatcggagatacaattgctttgtctgtatccacgccaaagcatttgcataagattggt
ctattgcctaagacgagccgcacgtacgaagctgatataaattatctgtacaaaattgga
ttagataaaatagtgtttttacctttcggatatttaatggatctatggaggtggaacgtg
ttcaaaggtataacgacggaagatcaatacaattgcgattggtggaaacttaaatattct
tatcaaggaatcgagccacctgtgaccagaactgaaaacgattttgatcctggttccaag
taccacatcgttggaagcgtgccttacattagatactttgtgagtttcatcgtacagttt
caattccatcaagcattgtgcgagaaagctggtcaatttgatccgaaaaatcctacaagc
aaaccgttacacgaatgtgacatttatcaaagcacaaatgccggaaacgctttcaaagaa
atgctgaaattaggatcgtcgaaaccgtggtttgacgctatggaattactaacgggacaa
agagaaatggacgctggacctttgttgaactatttcagccctttgtacgaatggcttcaa
aatgaaaataaaagaactggcgaacatctaggctgggaaacaaataaaaaaatttgctta
aagaagggtgaaacaagtcaaccttaa

DBGET integrated database retrieval system