KEGG   Diuraphis noxia (Russian wheat aphid): 107168474Help
Entry
107168474         CDS       T04900                                 

Definition
(RefSeq) annulin-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Brite
Enzymes [BR:dnx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107168474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 746 aa AA seqDB search
MTDCFGLCRLFEREHSSGKMGNDLSKPNENYIVVPTGDNMIRRSPNTTDMGPLNLEWINY
CFVKNGQKHRTDKYYCMGERNPTLVVRRGLPICFYLKFDREFDMANDSVSFMFKLAETGD
ANFGNNTMAAVPLKENPSNGNGHWSAYVMSTDDLDPNVVSVRITPPNNCIVGQWVFDIDT
RSGQEAAMFSAEGNPIYILFNPWCPTDEVYIKDDALRDEYVLSEEGLMWRGSHSRQKEVM
WKYGQFQKNMLESSFLLLLNIRRLALIHCSDPVKVSRSLSAAVNAPDELGVVQGNWTEDF
SGGTPPINWLGSVDILNQFFKTKKPVKYGQXWVYAGVLTTVCRAIGIPCRPVTAYCAAHD
TQNSLTIDYLVDDDGKIIEELQTDSIWNYHVWNEVWMARPDLNILDRSWQVIDATPQELS
EGQFKCGPASVTAVKNGDIRAPYDTAFVYSEVNADKVYWRYYGISQPMKLLRKDTEAIGK
LICTKAAGKWEQENITENYKYPEKSTEERITMHKALKQNNSIFSRYYLNEDFNEIKFDFE
LVDDIIVGENFRVAVRITNKGHKDYTVKVILRVDTVDYTGKNGSLVTKVEQQKVVLHDPG
SNVEYVQTALTYFDYGNDVKSQNVFNISCLASVVDTDYEYFGQDDFRVRKPDIEFEMHDK
PTMSREVRAIVKLRNPLPLTLKDGKFFIAGSSLPKTLEIKVGKVSAKKTTSVPFKFTPQF
TGKQVISAKFTSKQLQDVDGYLQFMV
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgacagattgtttcggactatgccggttattcgaacgggaacactcgagcggcaagatg
ggtaatgatctgtctaaaccgaatgagaattacatagtggtaccaaccggtgacaacatg
attcgccgatcaccaaacacgactgatatgggtccattaaacctagaatggattaactac
tgcttcgtgaaaaacggacaaaaacacaggaccgataagtattattgtatgggcgaaagg
aatccaactttagtggtacgcagaggacttcctatttgcttttacttaaaatttgacaga
gagtttgacatggctaatgacagtgtgtcgtttatgttcaaattggctgaaacaggagat
gcaaactttggtaataacactatggctgctgtgccattaaaggaaaatccaagtaatggc
aatggccattggtcagcatacgtaatgtctactgatgacttggatccaaatgtagtcagc
gttaggattacaccaccgaataactgcattgtgggacagtgggtatttgacattgacacc
cgatctggacaagaagcggcaatgttttcagctgaaggaaatccaatttacatactgttc
aatccgtggtgtccaacggatgaagtttatataaaggacgatgcgttgcgtgacgagtac
gtattaagcgaagaaggacttatgtggcgcggaagtcatagcagacagaaagaagtcatg
tggaagtacggtcagtttcaaaagaacatgctagagagtagttttttgttattgttaaat
atcagacggttagcacttatacactgcagtgacccagtaaaagtatcaagaagcctatcg
gccgcggtaaatgctccagatgagttaggagtcgttcaaggcaattggaccgaagacttt
tctggcggcactccacctattaattggctgggaagcgtagacattttaaatcaattcttc
aaaacgaaaaaacctgtcaaatatgggcagtkctgggtgtatgctggagtactaactaca
gtatgcagagctatcggaataccttgccgtccggtgactgcatattgcgcagctcatgac
acacaaaacagtttaacgatcgattacttagtcgatgatgacggaaaaataatagaagaa
ctacaaaccgactctatttggaactatcacgtatggaacgaggtttggatggccagacca
gatctgaacatcttggaccggagctggcaagtgatcgatgccacaccacaggagctgagt
gaaggtcagttcaaatgtggcccagccagcgtaacggccgttaaaaatggtgacataaga
gcaccgtatgacacagcgttcgtgtactccgaggtgaacgcagataaggtatactggaga
tactatggcatatctcaaccaatgaagctgttgaggaaggacactgaagcaatcggaaaa
cttatttgtacgaaagcggctggaaaatgggaacaggaaaacattacggaaaactacaaa
tatcctgaaaagtcaactgaagaaaggataactatgcataaagcattaaagcaaaataat
agcatatttagccgttattacttgaatgaggatttcaatgaaatcaaatttgactttgag
ttagttgatgatattattgtgggagaaaacttcagggttgcggtgagaatcacgaacaaa
ggtcataaagattacacagttaaagtgatattgcgtgtcgatacggttgattataccgga
aaaaatggatctctcgtcaccaaagtcgaacaacaaaaagtagtgcttcatgatccagga
tcaaacgttgaatatgtccaaaccgcattgacgtattttgattatggcaatgacgttaaa
agccaaaatgttttcaacatatcatgtctagcgagcgtggttgacacagattacgagtat
ttcggacaggacgattttagagtcagaaaaccagatattgaattcgaaatgcacgataaa
cctaccatgtcacgtgaagtgcgggctattgttaagcttagaaatccgttgcccctgact
ttaaaagatggaaaattcttcatcgctggttcatcgttgcctaaaactctggaaatcaaa
gttggtaaagtcagtgcaaagaaaacgaccagtgtaccgttcaaattcactccccaattc
accggaaagcaagtaatttctgcaaaatttacgtccaaacaactgcaagatgtcgatggt
tatttacaatttatggtgtaa

DBGET integrated database retrieval system