KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0742500-01Help
Entry
Os01t0742500-01   CDS       T02163                                 

Gene name
Os01g0742500, HXK6, HEXOKINASE-6
Definition
(RAP-DB) Similar to Hexokinase.
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os01t0742500-01 (Os01g0742500)
   00051 Fructose and mannose metabolism
    Os01t0742500-01 (Os01g0742500)
   00052 Galactose metabolism
    Os01t0742500-01 (Os01g0742500)
   00500 Starch and sucrose metabolism
    Os01t0742500-01 (Os01g0742500)
   00520 Amino sugar and nucleotide sugar metabolism
    Os01t0742500-01 (Os01g0742500)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Os01t0742500-01 (Os01g0742500)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Os01t0742500-01 (Os01g0742500)
Membrane trafficking [BR:dosa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Os01t0742500-01 (Os01g0742500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
LinkDB All DBs
Position
chr01:complement(join(31013474..31013769,31012575..31012725,31012296..31012478,31011619..31011693,31011253..31011408,31011014..31011112,31010810..31010940,31010515..31010596,31010075..31010422))
AA seq 506 aa AA seqDB search
MGKGTVVGTAVVVCAAAAAAVGVAVVVSRRRRSKREAEEERRRRAAAVIEEVEQRFSTPT
ALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIRV
QLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELESFVKTEGEDFHLPEGRQREL
GFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAELSRAMERQGLDMKVTALVNDTV
GTLAGGRYVDNDVAAAVILGTGTNAAYVEHANAIPKWTGLLPRSGNMVINMEWGNFKSER
LPRSDYDNALDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPTKLEQR
FILRTPDMSAMHHDTSHDLKHLGAKLKDILGVADTSLEARYITLHVCDLVAERGARLAAA
GIYGILKKLGRDRVPSDGSQKQRTVIALDGGLYEHYKKFRTCLEATLADLLGEEAASSVV
VKLANDGSGIGAALLAASHSQYASVE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggggacggtagtggggacggcggtggtggtgtgcgctgcagcggccgcggcg
gttggggtggcggtggtggtgtcgcggaggaggaggagcaagcgggaggcggaggaggag
cggcggaggagggccgccgctgtgatcgaggaggtggagcagaggttctcgacgcccacg
gcgctgctgcgcggcatcgcggacgccatggtggaggagatggagcgcggcctccgcgcc
gaccctcacgccccgctcaagatgctcatcagctacgtcgacaacctccccaccggggat
gagcacggactgttctatgctctcgatcttgggggcaccaatttccgtgttatacgtgtt
cagcttggaggaagggaaaagcgtgttgttagtcaacagtacgaagaggttgccattcca
cctcacctgatggttgggacttctatggaactgtttgacttcattgcggctgagttggaa
agttttgtcaagaccgagggagaggatttccacttgccagagggcaggcagagagagtta
ggcttcaccttttctttcccagtgcaccaaacatcaatatcatcaggcactcttattaag
tggacaaagggattttccatcaatggcacggtgggggaagatgttgtggctgaattgagc
agggctatggaaaggcaagggcttgatatgaaagttacagctcttgttaatgacactgta
ggcacattggctggcggaagatatgttgataatgacgttgctgctgctgtaatattaggc
actggcacaaacgcagcctacgtggagcatgcaaatgcaattccaaaatggactggatta
ctacctagatcaggaaatatggtgattaacatggaatggggaaacttcaagtcagaaagg
cttcctcgttcagattacgataatgccttggactttgaaagtttaaacccaggcgagcag
atatatgaaaagatgatttccggcatgtatcttggagagattgtgcgcagaatcttgctt
aagcttgctcatgatgcttccttgtttggagatgttgttccaacaaagctggagcagcgc
tttatactgaggacgccggacatgtcagcgatgcatcatgatacctcacatgatctgaaa
cacctgggagctaagctgaaggatatcctgggggtcgctgatacttccctggaagcacga
tacatcacccttcatgtctgcgacctcgttgcagagagaggtgcacgcttagctgctgct
ggtatatatggcattctaaagaagctgggcagggacagagtgccaagtgacggtagtcaa
aagcagaggactgtcattgctctggatggtggtctctatgagcattacaagaagttcaga
acctgcctagaagcaacgcttgcagacctgcttggagaggaggctgcctcatcagttgtt
gtcaagttggcaaacgatggctctggcatcggagctgcacttcttgcagcatctcactcc
cagtatgctagcgtcgagtag

DBGET integrated database retrieval system