KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0665200-01Help
Entry
Os07t0665200-01   CDS       T02163                                 

Gene name
Os07g0665200
Definition
(RAP-DB) Similar to Superoxide dismutase [Cu-Zn].
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Os07t0665200-01 (Os07g0665200)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Os07t0665200-01 (Os07g0665200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
LinkDB All DBs
Position
chr07:complement(join(28076870..28076948,28076684..28076785,28076500..28076595,28076306..28076337,28076124..28076199,28075934..28075987,28075775..28075797))
AA seq 153 aa AA seqDB search
TMVKAVAVLASSEGVKGTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMST
GPHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVH
ADPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
acaatggtgaaggctgttgctgtgcttgctagcagtgagggtgtcaagggcaccatcttt
ttctcccaagagggagatggtccgacctctgtgacgggaagtgtctctgggctcaagcca
gggctccatggattccatgtgcacgcgctcggtgacaccactaatggctgcatgtcaact
ggaccacacttcaatcctactgggaaggaacatggggcaccacaagatgagaaccgccat
gccggtgatcttggaaatataacagctggagcagatggtgttgctaatgtcaatgtctct
gacagccagatcccccttactggagcacactccatcattggccgagctgttgttgtccat
gctgatcctgatgatcttggcaagggtggacatgagcttagcaagaccactggaaatgct
gggggccgagttgcttgcggaatcatcggactccagggttag

DBGET integrated database retrieval system